Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A448YP62

Protein Details
Accession A0A448YP62   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-43LLWKRPWRLSSTQKFRQRKRMQRVDSNIEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MIGPFRATLVDLGGLLWKRPWRLSSTQKFRQRKRMQRVDSNIENLFSGLQANGLKTHKIDQLKYQFPKEADMDPKDKYTVFNKHAKGYRKAAHFVPKWTKLSLRNNPDNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.15
4 0.17
5 0.19
6 0.22
7 0.24
8 0.26
9 0.34
10 0.44
11 0.52
12 0.59
13 0.66
14 0.73
15 0.81
16 0.82
17 0.84
18 0.84
19 0.84
20 0.85
21 0.86
22 0.83
23 0.83
24 0.83
25 0.8
26 0.72
27 0.66
28 0.55
29 0.45
30 0.37
31 0.28
32 0.2
33 0.12
34 0.09
35 0.05
36 0.06
37 0.06
38 0.06
39 0.09
40 0.1
41 0.1
42 0.1
43 0.13
44 0.16
45 0.18
46 0.19
47 0.24
48 0.31
49 0.39
50 0.41
51 0.4
52 0.39
53 0.37
54 0.39
55 0.34
56 0.31
57 0.29
58 0.3
59 0.31
60 0.29
61 0.3
62 0.28
63 0.26
64 0.24
65 0.25
66 0.3
67 0.32
68 0.39
69 0.4
70 0.47
71 0.53
72 0.57
73 0.57
74 0.57
75 0.58
76 0.55
77 0.57
78 0.54
79 0.58
80 0.54
81 0.57
82 0.58
83 0.59
84 0.57
85 0.56
86 0.57
87 0.56
88 0.63
89 0.64
90 0.65