Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401L5R7

Protein Details
Accession A0A401L5R7    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
356-384LSVTRGKGFTKEKNKKKRGSYRGGPIDISHydrophilic
NLS Segment(s)
PositionSequence
140-148KKPAAPAAK
362-375KGFTKEKNKKKRGS
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences MAGQKSKQAKPAKASKSKETPAPPAQLVAALSAFLSESGFSKTKEAFTKELASKSIDSDAKNVPSLLELYQSWEKSSEKSSGSSSSDSESESDSGSESGSESDSESSDSSSDESSDSDVEMNDKSESDSDSDSDDEEEKKKPAAPAAKSQGTKRKAESSSSESDSESEADEAPKSKKTKVTSAKEESSDSDSSDSESDSSSSSSESEESSDSDSSSDDSSSSSSESDSDSDSDSDSDSSSDDEDKKADKKALKAATKTPLPPSESSSSGSSPSSSSDSDTTGTVSNSDSAPKEQSKSAQTSYSSSASPAPGNGPQKKKHTGARPTPLAQLSELPTDHLLSNDYVPYAYAEKAWQDLSVTRGKGFTKEKNKKKRGSYRGGPIDISGGKSFKFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.78
4 0.76
5 0.75
6 0.71
7 0.7
8 0.67
9 0.67
10 0.58
11 0.5
12 0.45
13 0.39
14 0.33
15 0.25
16 0.18
17 0.11
18 0.1
19 0.09
20 0.08
21 0.06
22 0.06
23 0.05
24 0.06
25 0.12
26 0.14
27 0.15
28 0.19
29 0.21
30 0.26
31 0.33
32 0.36
33 0.34
34 0.36
35 0.44
36 0.45
37 0.46
38 0.42
39 0.38
40 0.35
41 0.33
42 0.36
43 0.31
44 0.28
45 0.29
46 0.32
47 0.32
48 0.32
49 0.3
50 0.23
51 0.21
52 0.21
53 0.17
54 0.15
55 0.12
56 0.17
57 0.22
58 0.22
59 0.22
60 0.23
61 0.24
62 0.23
63 0.27
64 0.26
65 0.22
66 0.24
67 0.26
68 0.28
69 0.3
70 0.29
71 0.27
72 0.24
73 0.23
74 0.22
75 0.2
76 0.17
77 0.15
78 0.13
79 0.12
80 0.11
81 0.1
82 0.09
83 0.09
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.08
90 0.08
91 0.1
92 0.09
93 0.09
94 0.09
95 0.09
96 0.09
97 0.09
98 0.09
99 0.08
100 0.08
101 0.09
102 0.09
103 0.09
104 0.08
105 0.08
106 0.09
107 0.09
108 0.09
109 0.09
110 0.08
111 0.09
112 0.09
113 0.1
114 0.11
115 0.11
116 0.1
117 0.11
118 0.12
119 0.11
120 0.12
121 0.12
122 0.13
123 0.14
124 0.16
125 0.15
126 0.16
127 0.19
128 0.18
129 0.23
130 0.29
131 0.3
132 0.36
133 0.42
134 0.47
135 0.47
136 0.5
137 0.53
138 0.5
139 0.49
140 0.44
141 0.45
142 0.4
143 0.42
144 0.42
145 0.39
146 0.4
147 0.4
148 0.38
149 0.3
150 0.28
151 0.26
152 0.21
153 0.15
154 0.11
155 0.08
156 0.08
157 0.08
158 0.1
159 0.11
160 0.16
161 0.17
162 0.2
163 0.24
164 0.27
165 0.36
166 0.44
167 0.5
168 0.54
169 0.58
170 0.58
171 0.54
172 0.52
173 0.44
174 0.39
175 0.31
176 0.23
177 0.18
178 0.15
179 0.14
180 0.13
181 0.11
182 0.07
183 0.07
184 0.07
185 0.06
186 0.07
187 0.06
188 0.06
189 0.06
190 0.06
191 0.07
192 0.07
193 0.07
194 0.07
195 0.08
196 0.1
197 0.09
198 0.09
199 0.09
200 0.09
201 0.09
202 0.09
203 0.08
204 0.06
205 0.06
206 0.07
207 0.07
208 0.07
209 0.07
210 0.06
211 0.07
212 0.08
213 0.08
214 0.08
215 0.09
216 0.09
217 0.09
218 0.09
219 0.09
220 0.09
221 0.08
222 0.08
223 0.07
224 0.06
225 0.07
226 0.07
227 0.09
228 0.1
229 0.1
230 0.12
231 0.14
232 0.16
233 0.19
234 0.23
235 0.24
236 0.26
237 0.34
238 0.41
239 0.44
240 0.45
241 0.47
242 0.49
243 0.49
244 0.48
245 0.45
246 0.41
247 0.39
248 0.37
249 0.37
250 0.34
251 0.32
252 0.32
253 0.29
254 0.25
255 0.23
256 0.22
257 0.18
258 0.15
259 0.15
260 0.15
261 0.13
262 0.15
263 0.14
264 0.15
265 0.15
266 0.15
267 0.15
268 0.13
269 0.13
270 0.11
271 0.11
272 0.11
273 0.1
274 0.12
275 0.12
276 0.13
277 0.18
278 0.2
279 0.22
280 0.23
281 0.27
282 0.3
283 0.34
284 0.34
285 0.33
286 0.32
287 0.33
288 0.35
289 0.32
290 0.27
291 0.23
292 0.23
293 0.21
294 0.2
295 0.17
296 0.16
297 0.21
298 0.29
299 0.36
300 0.41
301 0.46
302 0.53
303 0.58
304 0.61
305 0.64
306 0.65
307 0.68
308 0.71
309 0.74
310 0.73
311 0.69
312 0.69
313 0.63
314 0.54
315 0.45
316 0.39
317 0.32
318 0.29
319 0.26
320 0.22
321 0.2
322 0.21
323 0.2
324 0.16
325 0.15
326 0.13
327 0.15
328 0.14
329 0.13
330 0.11
331 0.12
332 0.13
333 0.13
334 0.12
335 0.12
336 0.13
337 0.14
338 0.16
339 0.16
340 0.14
341 0.14
342 0.16
343 0.19
344 0.24
345 0.24
346 0.23
347 0.26
348 0.27
349 0.33
350 0.38
351 0.44
352 0.49
353 0.59
354 0.68
355 0.76
356 0.85
357 0.86
358 0.9
359 0.91
360 0.9
361 0.9
362 0.89
363 0.88
364 0.88
365 0.82
366 0.72
367 0.62
368 0.57
369 0.48
370 0.43
371 0.34
372 0.26
373 0.23