Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423XMB8

Protein Details
Accession A0A423XMB8    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
125-144KKLRTQAYANQKKRNRNTDPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 13.833, nucl 12, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001660  SAM  
IPR013761  SAM/pointed_sf  
Pfam View protein in Pfam  
PF07647  SAM_2  
PROSITE View protein in PROSITE  
PS50105  SAM_DOMAIN  
CDD cd09534  SAM_Ste11_fungal  
Amino Acid Sequences MAMLASKSPYAASLSSNQSTLIASSAGQPSYPPPRRAVTMPMHNQSFASPTESEFSEGDGPDSVKYWDEDSVCEYLRSVKCGDYEKLFRKNHINGENLLEMDKEVLKEMGIDKVGDRVRLFLGIKKLRTQAYANQKKRNRNTDPAVKDMDKAVGYLECPIRRPILTPDPAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.26
4 0.25
5 0.22
6 0.22
7 0.19
8 0.15
9 0.09
10 0.08
11 0.11
12 0.14
13 0.13
14 0.13
15 0.13
16 0.17
17 0.27
18 0.34
19 0.33
20 0.34
21 0.37
22 0.4
23 0.42
24 0.45
25 0.42
26 0.45
27 0.49
28 0.51
29 0.49
30 0.46
31 0.44
32 0.37
33 0.31
34 0.22
35 0.18
36 0.13
37 0.13
38 0.15
39 0.15
40 0.17
41 0.14
42 0.15
43 0.14
44 0.13
45 0.13
46 0.12
47 0.12
48 0.1
49 0.11
50 0.1
51 0.08
52 0.09
53 0.09
54 0.11
55 0.11
56 0.11
57 0.12
58 0.14
59 0.13
60 0.13
61 0.12
62 0.16
63 0.16
64 0.18
65 0.16
66 0.16
67 0.18
68 0.22
69 0.23
70 0.2
71 0.26
72 0.29
73 0.38
74 0.37
75 0.37
76 0.4
77 0.42
78 0.46
79 0.44
80 0.41
81 0.32
82 0.35
83 0.34
84 0.28
85 0.24
86 0.16
87 0.11
88 0.1
89 0.09
90 0.06
91 0.06
92 0.06
93 0.05
94 0.06
95 0.07
96 0.09
97 0.09
98 0.09
99 0.08
100 0.15
101 0.16
102 0.17
103 0.16
104 0.16
105 0.16
106 0.19
107 0.2
108 0.17
109 0.26
110 0.29
111 0.31
112 0.34
113 0.37
114 0.35
115 0.38
116 0.37
117 0.36
118 0.42
119 0.51
120 0.55
121 0.61
122 0.66
123 0.73
124 0.79
125 0.81
126 0.77
127 0.76
128 0.77
129 0.78
130 0.76
131 0.71
132 0.68
133 0.59
134 0.52
135 0.44
136 0.39
137 0.28
138 0.24
139 0.2
140 0.15
141 0.14
142 0.19
143 0.23
144 0.22
145 0.24
146 0.26
147 0.28
148 0.28
149 0.3
150 0.33
151 0.37