Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423XH62

Protein Details
Accession A0A423XH62    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-115RQITPPVPRTPRRKEEKPKISRPDLESHydrophilic
NLS Segment(s)
PositionSequence
99-107PRRKEEKPK
Subcellular Location(s) plas 13, golg 5, extr 3, E.R. 3, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLAPILSPMWFVILLATPILAIILATLLPRTEPTEWVEFNNTDARPEAEAEPMPEYDDPYLRPDHPFWEGHPPLEVIAGGYTWDPPSLRQITPPVPRTPRRKEEKPKISRPDLES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.06
5 0.06
6 0.06
7 0.05
8 0.03
9 0.02
10 0.03
11 0.03
12 0.03
13 0.04
14 0.04
15 0.04
16 0.05
17 0.09
18 0.09
19 0.11
20 0.15
21 0.19
22 0.2
23 0.21
24 0.24
25 0.21
26 0.22
27 0.25
28 0.21
29 0.18
30 0.18
31 0.17
32 0.15
33 0.16
34 0.15
35 0.12
36 0.12
37 0.12
38 0.13
39 0.12
40 0.12
41 0.1
42 0.1
43 0.09
44 0.09
45 0.09
46 0.1
47 0.12
48 0.12
49 0.14
50 0.14
51 0.15
52 0.18
53 0.18
54 0.17
55 0.26
56 0.25
57 0.24
58 0.24
59 0.22
60 0.19
61 0.19
62 0.16
63 0.07
64 0.06
65 0.06
66 0.05
67 0.05
68 0.06
69 0.06
70 0.07
71 0.07
72 0.07
73 0.14
74 0.18
75 0.18
76 0.21
77 0.26
78 0.34
79 0.42
80 0.46
81 0.47
82 0.52
83 0.6
84 0.66
85 0.7
86 0.73
87 0.74
88 0.8
89 0.83
90 0.86
91 0.89
92 0.9
93 0.9
94 0.9
95 0.89