Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423XM84

Protein Details
Accession A0A423XM84    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
26-60AKLFRFCRSKCHKNFKMKRNPRKLKWTKAFRKAAGHydrophilic
NLS Segment(s)
PositionSequence
40-59FKMKRNPRKLKWTKAFRKAA
101-104RRRE
Subcellular Location(s) mito 15.5, mito_nucl 10.833, cyto 6.5, cyto_nucl 6.333, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR011017  TRASH_dom  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRIETCYFCSRPAYPSKGITFVRNDAKLFRFCRSKCHKNFKMKRNPRKLKWTKAFRKAAGKEMTVDSTLVFGARRNVPVKYDRDLVQKTLKAMERIGEIRRRRERVFYKQRMAGRRAQELREARKLFCWIDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.45
4 0.48
5 0.48
6 0.47
7 0.43
8 0.43
9 0.45
10 0.42
11 0.4
12 0.37
13 0.4
14 0.42
15 0.4
16 0.4
17 0.41
18 0.39
19 0.49
20 0.54
21 0.6
22 0.64
23 0.72
24 0.75
25 0.77
26 0.87
27 0.87
28 0.89
29 0.89
30 0.9
31 0.91
32 0.92
33 0.88
34 0.89
35 0.88
36 0.87
37 0.86
38 0.86
39 0.84
40 0.84
41 0.84
42 0.76
43 0.77
44 0.68
45 0.66
46 0.58
47 0.49
48 0.41
49 0.35
50 0.32
51 0.22
52 0.2
53 0.12
54 0.09
55 0.08
56 0.07
57 0.06
58 0.05
59 0.08
60 0.1
61 0.13
62 0.14
63 0.15
64 0.17
65 0.23
66 0.26
67 0.26
68 0.28
69 0.27
70 0.33
71 0.34
72 0.35
73 0.35
74 0.34
75 0.31
76 0.33
77 0.34
78 0.28
79 0.27
80 0.25
81 0.23
82 0.24
83 0.29
84 0.31
85 0.33
86 0.42
87 0.5
88 0.54
89 0.53
90 0.6
91 0.63
92 0.66
93 0.73
94 0.73
95 0.72
96 0.72
97 0.77
98 0.75
99 0.71
100 0.67
101 0.61
102 0.62
103 0.6
104 0.55
105 0.57
106 0.58
107 0.61
108 0.63
109 0.6
110 0.51
111 0.51
112 0.54