Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423XLS5

Protein Details
Accession A0A423XLS5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-74IHWATLKPEQKQKKKKDDKGGKGGPAKKBasic
NLS Segment(s)
PositionSequence
56-74QKQKKKKDDKGGKGGPAKK
Subcellular Location(s) mito 8, cyto 7, extr 6, plas 3, E.R. 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGQFDWFRAIGATQQAVNVLNDQPYLFTILIVVLIILILEGVFIWYIHWATLKPEQKQKKKKDDKGGKGGPAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.15
5 0.14
6 0.11
7 0.11
8 0.11
9 0.1
10 0.1
11 0.09
12 0.11
13 0.09
14 0.08
15 0.08
16 0.07
17 0.07
18 0.06
19 0.06
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.01
26 0.01
27 0.01
28 0.02
29 0.02
30 0.02
31 0.03
32 0.04
33 0.04
34 0.04
35 0.05
36 0.06
37 0.09
38 0.18
39 0.24
40 0.29
41 0.38
42 0.48
43 0.58
44 0.69
45 0.76
46 0.79
47 0.84
48 0.89
49 0.91
50 0.92
51 0.91
52 0.91
53 0.89
54 0.86