Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423WDS9

Protein Details
Accession A0A423WDS9    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-32TDVTRRYVRKWDHSWRRNVCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11.333, cyto 9, cyto_mito 7.333, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
Amino Acid Sequences MSYCIAFSVDGATDVTRRYVRKWDHSWRRNVCSEEVLLHILQEIRAESRKSKTKEEKHRLDSEDSAEAMELLNGIVAPLTLELSRLYTTSQPLPGESSTAVARNETLTLTQSDTLAWDVSDASEHGTGANLRADER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.15
3 0.17
4 0.18
5 0.21
6 0.29
7 0.36
8 0.44
9 0.52
10 0.6
11 0.67
12 0.74
13 0.81
14 0.8
15 0.79
16 0.76
17 0.7
18 0.61
19 0.53
20 0.46
21 0.37
22 0.3
23 0.25
24 0.19
25 0.15
26 0.14
27 0.11
28 0.1
29 0.09
30 0.08
31 0.08
32 0.12
33 0.14
34 0.16
35 0.22
36 0.3
37 0.33
38 0.42
39 0.5
40 0.57
41 0.67
42 0.74
43 0.77
44 0.75
45 0.78
46 0.71
47 0.64
48 0.55
49 0.46
50 0.38
51 0.28
52 0.22
53 0.15
54 0.12
55 0.09
56 0.07
57 0.04
58 0.03
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.03
67 0.03
68 0.04
69 0.04
70 0.06
71 0.06
72 0.07
73 0.08
74 0.09
75 0.12
76 0.13
77 0.16
78 0.15
79 0.16
80 0.18
81 0.17
82 0.17
83 0.15
84 0.14
85 0.12
86 0.14
87 0.14
88 0.12
89 0.12
90 0.11
91 0.12
92 0.11
93 0.1
94 0.09
95 0.11
96 0.12
97 0.13
98 0.12
99 0.11
100 0.12
101 0.12
102 0.11
103 0.09
104 0.07
105 0.07
106 0.07
107 0.08
108 0.07
109 0.09
110 0.09
111 0.09
112 0.09
113 0.11
114 0.11
115 0.12
116 0.16