Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1CDH4

Protein Details
Accession A0A0D1CDH4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MWWRWCGAPKRRRRRNKKVKITHAHIHIRDBasic
NLS Segment(s)
PositionSequence
9-20PKRRRRRNKKVK
Subcellular Location(s) mito 14, nucl 10.5, cyto_nucl 8
Family & Domain DBs
KEGG uma:UMAG_01047  -  
Amino Acid Sequences MWWRWCGAPKRRRRRNKKVKITHAHIHIRDSRLSKSSLGLPTSTRQITNEIKHSTAQHKTRRSRKSAAIQFCEDKVFVPDRWIEKIEIKFAISMEHTQSSHHTAIRNTNAIPQPLGVIQTRKEQGDPSGQLRSRSHDNIVHLQTQDPLTLQGESKSASLVQRSTSSSASFTIQSGLSTSWFQVKDRRTPESTSCTSTPSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.94
3 0.96
4 0.96
5 0.96
6 0.96
7 0.95
8 0.92
9 0.88
10 0.86
11 0.84
12 0.74
13 0.7
14 0.65
15 0.57
16 0.54
17 0.49
18 0.44
19 0.37
20 0.38
21 0.32
22 0.28
23 0.32
24 0.31
25 0.3
26 0.27
27 0.26
28 0.27
29 0.32
30 0.31
31 0.25
32 0.21
33 0.26
34 0.31
35 0.34
36 0.38
37 0.35
38 0.35
39 0.37
40 0.39
41 0.39
42 0.41
43 0.45
44 0.46
45 0.53
46 0.61
47 0.69
48 0.73
49 0.74
50 0.72
51 0.72
52 0.74
53 0.74
54 0.72
55 0.68
56 0.63
57 0.58
58 0.52
59 0.45
60 0.34
61 0.25
62 0.2
63 0.18
64 0.14
65 0.15
66 0.17
67 0.18
68 0.21
69 0.22
70 0.2
71 0.23
72 0.24
73 0.24
74 0.21
75 0.19
76 0.17
77 0.16
78 0.15
79 0.11
80 0.11
81 0.1
82 0.11
83 0.11
84 0.11
85 0.13
86 0.16
87 0.16
88 0.16
89 0.17
90 0.16
91 0.21
92 0.24
93 0.24
94 0.2
95 0.24
96 0.25
97 0.23
98 0.22
99 0.17
100 0.15
101 0.14
102 0.15
103 0.11
104 0.1
105 0.11
106 0.17
107 0.18
108 0.18
109 0.18
110 0.18
111 0.19
112 0.24
113 0.25
114 0.23
115 0.29
116 0.3
117 0.34
118 0.34
119 0.36
120 0.35
121 0.34
122 0.35
123 0.31
124 0.34
125 0.37
126 0.39
127 0.38
128 0.32
129 0.3
130 0.29
131 0.26
132 0.22
133 0.15
134 0.13
135 0.11
136 0.12
137 0.12
138 0.11
139 0.11
140 0.12
141 0.11
142 0.11
143 0.11
144 0.12
145 0.14
146 0.15
147 0.16
148 0.18
149 0.21
150 0.23
151 0.22
152 0.22
153 0.2
154 0.21
155 0.2
156 0.18
157 0.16
158 0.15
159 0.14
160 0.13
161 0.13
162 0.12
163 0.12
164 0.12
165 0.13
166 0.18
167 0.18
168 0.2
169 0.26
170 0.31
171 0.38
172 0.43
173 0.49
174 0.46
175 0.51
176 0.56
177 0.58
178 0.56
179 0.54
180 0.49