Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423VZW7

Protein Details
Accession A0A423VZW7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-94ARPPTPTTTKTPRGNRRRESLSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, E.R. 4, mito 3, cyto 1, extr 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRDHLPPLSMVPSLYEVGTAIRSRMIGWNVVSNSTSWVVQLISWFFITLALSLFLPLAGLVIFDFFLWLWRLARPPTPTTTKTPRGNRRRESLSHPVTTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.1
4 0.1
5 0.13
6 0.12
7 0.1
8 0.1
9 0.1
10 0.11
11 0.16
12 0.16
13 0.16
14 0.16
15 0.21
16 0.21
17 0.22
18 0.21
19 0.16
20 0.17
21 0.15
22 0.14
23 0.09
24 0.09
25 0.08
26 0.08
27 0.09
28 0.07
29 0.07
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.06
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.03
44 0.03
45 0.02
46 0.03
47 0.02
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.05
54 0.06
55 0.08
56 0.08
57 0.1
58 0.13
59 0.15
60 0.21
61 0.24
62 0.26
63 0.31
64 0.37
65 0.4
66 0.44
67 0.51
68 0.55
69 0.6
70 0.67
71 0.72
72 0.75
73 0.82
74 0.82
75 0.82
76 0.8
77 0.76
78 0.74
79 0.74
80 0.71