Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423X4K3

Protein Details
Accession A0A423X4K3   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
78-100ERRGCKARDVDRRRKSWNKKVYVBasic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, pero 2
Family & Domain DBs
Amino Acid Sequences MDEDRRSDYGHCQPGHPKAERAQLKEKASQLMAKRPVYPLTNRRQFEPTDRALPGDTEAHRYDDDELCRKLLPRDDQERRGCKARDVDRRRKSWNKKVYVGVVEEAWSFADSDVDLMKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.58
3 0.53
4 0.48
5 0.45
6 0.54
7 0.57
8 0.57
9 0.57
10 0.57
11 0.58
12 0.59
13 0.56
14 0.49
15 0.45
16 0.43
17 0.38
18 0.39
19 0.42
20 0.38
21 0.38
22 0.36
23 0.38
24 0.36
25 0.4
26 0.4
27 0.43
28 0.5
29 0.49
30 0.5
31 0.49
32 0.47
33 0.47
34 0.45
35 0.38
36 0.33
37 0.33
38 0.3
39 0.27
40 0.26
41 0.2
42 0.18
43 0.15
44 0.15
45 0.15
46 0.16
47 0.16
48 0.16
49 0.17
50 0.17
51 0.19
52 0.19
53 0.19
54 0.18
55 0.19
56 0.2
57 0.2
58 0.23
59 0.26
60 0.29
61 0.39
62 0.45
63 0.53
64 0.6
65 0.63
66 0.61
67 0.62
68 0.56
69 0.5
70 0.52
71 0.53
72 0.56
73 0.61
74 0.68
75 0.69
76 0.75
77 0.79
78 0.81
79 0.82
80 0.82
81 0.82
82 0.79
83 0.76
84 0.76
85 0.73
86 0.67
87 0.59
88 0.5
89 0.4
90 0.33
91 0.27
92 0.22
93 0.16
94 0.12
95 0.1
96 0.08
97 0.08
98 0.07
99 0.08