Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423XNM3

Protein Details
Accession A0A423XNM3    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
98-125PEDASRKLEKTKKRQQHFPQRKYAIKASHydrophilic
NLS Segment(s)
PositionSequence
85-114RPKQTRAIRRRLSPEDASRKLEKTKKRQQH
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSSKIKAGQLWSKNKEELTKTLGELKTELGQLRIQKIVSSGTKLNKIHDLRKSIARVLTIINAKQRHQLRLFYKNKKYLPLDLRPKQTRAIRRRLSPEDASRKLEKTKKRQQHFPQRKYAIKASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.57
3 0.56
4 0.51
5 0.46
6 0.41
7 0.37
8 0.34
9 0.39
10 0.38
11 0.32
12 0.29
13 0.27
14 0.24
15 0.24
16 0.23
17 0.16
18 0.18
19 0.2
20 0.21
21 0.21
22 0.19
23 0.17
24 0.18
25 0.2
26 0.19
27 0.2
28 0.21
29 0.23
30 0.3
31 0.3
32 0.31
33 0.35
34 0.37
35 0.4
36 0.41
37 0.42
38 0.38
39 0.43
40 0.43
41 0.37
42 0.35
43 0.29
44 0.24
45 0.2
46 0.22
47 0.18
48 0.17
49 0.2
50 0.2
51 0.2
52 0.26
53 0.28
54 0.29
55 0.3
56 0.35
57 0.36
58 0.45
59 0.53
60 0.56
61 0.61
62 0.63
63 0.63
64 0.62
65 0.6
66 0.58
67 0.56
68 0.56
69 0.6
70 0.58
71 0.66
72 0.63
73 0.62
74 0.6
75 0.6
76 0.61
77 0.59
78 0.63
79 0.61
80 0.64
81 0.7
82 0.7
83 0.69
84 0.66
85 0.68
86 0.67
87 0.64
88 0.63
89 0.58
90 0.55
91 0.57
92 0.58
93 0.58
94 0.59
95 0.65
96 0.7
97 0.75
98 0.82
99 0.85
100 0.89
101 0.9
102 0.88
103 0.88
104 0.87
105 0.86
106 0.82