FuNGI

A0A0D1EA74

Protein Details

Accession

A0A0D1EA74

Localization Confidence

Low

Confidence Score

5.9

NoLS Segment(s)

Position	Sequence	Protein Nature
621-642	APLPKAVKQVKKQQDDLKKQSW	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 20, cyto_nucl 3, nucl 2.5, cyto 2.5

Family & Domain DBs

InterPro	View protein in InterPro IPR036188 FAD/NAD-bd_sf IPR023753 FAD/NAD-binding_dom IPR015904 Sulphide_quinone_reductase
Gene Ontology	GO:0005739 C:mitochondrion GO:0071949 F:FAD binding GO:0016705 F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen GO:0070224 F:sulfide:quinone oxidoreductase activity GO:0070221 P:sulfide oxidation, using sulfide:quinone oxidoreductase
KEGG	uma:UMAG_01195 -
Pfam	View protein in Pfam PF12824 MRP-L20 PF07992 Pyr_redox_2

Amino Acid Sequences

MHAMLNSTLAATARVSRSRFGSVSQAVRSLATVSGSPVRHGASGSSNHKVAVIGGGSAGMLVSHQLLRSGAFAQDDIAVVDPSEWHHYQPGWTLVGGGLKDKRDLRRPLASLLDPKLKHYASAVDTFAPEQNQITLANGNKIAYDQLVVVPGLSINYDAIKGLPEALADPSSLVSTIYGYDTCDKVFDTIAKLKSGKAIFTQPAGVIKCAGAPQKAMWLALDHWKKGGLYNPADPANSPISIDFATGMPVMFGVPKYSERLNELRQQRGVEGLFQHDLVAIEGNTAVFARPDGAEQVRKQFDLLHVTPKMGPLTVIKNSALADGAGFVDVDQETTRHKRFDNVWSIGDASSLPTSKTAAAITAEAPVLVRNLGQAIQGKHPDAAYDGYTSCPLLTEYGKVMLAEFKYGGIPKETFGSLFGIDQGVPRTAFYHLKKDFFPWIYYNSYVKGTWAGPKGWSFASAPLSSEAVAGKRAFSTSRTVPQQAPGSRRGFATSSVGLRNTPARRPRDPLDASPDAIRHTLPSGETFIVRPPPSSAPARSTVYQPQPLLHAQPASDSSSLPPALRPRSRFAARRETTEVAVTPDQIAEIQRLRRQDPITYTKSKLAKQFNCSPLFISIIAPLPKAVKQVKKQQDDLKKQSWGLNKRVARAEREERRLLW

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.25
2	0.27
3	0.29
4	0.33
5	0.37
6	0.37
7	0.34
8	0.37
9	0.38
10	0.42
11	0.41
12	0.4
13	0.35
14	0.34
15	0.32
16	0.25
17	0.2
18	0.15
19	0.13
20	0.14
21	0.2
22	0.2
23	0.21
24	0.22
25	0.22
26	0.21
27	0.21
28	0.21
29	0.2
30	0.28
31	0.32
32	0.35
33	0.34
34	0.33
35	0.33
36	0.31
37	0.25
38	0.21
39	0.16
40	0.11
41	0.11
42	0.1
43	0.09
44	0.09
45	0.08
46	0.04
47	0.03
48	0.04
49	0.05
50	0.07
51	0.07
52	0.08
53	0.09
54	0.1
55	0.12
56	0.13
57	0.12
58	0.12
59	0.12
60	0.12
61	0.13
62	0.12
63	0.11
64	0.11
65	0.09
66	0.08
67	0.08
68	0.08
69	0.09
70	0.15
71	0.15
72	0.15
73	0.18
74	0.19
75	0.21
76	0.26
77	0.27
78	0.22
79	0.21
80	0.2
81	0.19
82	0.21
83	0.19
84	0.19
85	0.19
86	0.19
87	0.24
88	0.29
89	0.35
90	0.41
91	0.48
92	0.51
93	0.56
94	0.57
95	0.56
96	0.57
97	0.54
98	0.51
99	0.49
100	0.51
101	0.42
102	0.43
103	0.45
104	0.39
105	0.35
106	0.31
107	0.31
108	0.26
109	0.3
110	0.28
111	0.22
112	0.23
113	0.24
114	0.24
115	0.19
116	0.16
117	0.13
118	0.12
119	0.12
120	0.12
121	0.12
122	0.14
123	0.14
124	0.17
125	0.17
126	0.16
127	0.15
128	0.15
129	0.15
130	0.11
131	0.1
132	0.08
133	0.08
134	0.09
135	0.09
136	0.08
137	0.08
138	0.07
139	0.07
140	0.06
141	0.06
142	0.05
143	0.06
144	0.06
145	0.06
146	0.06
147	0.07
148	0.07
149	0.07
150	0.07
151	0.07
152	0.07
153	0.09
154	0.09
155	0.08
156	0.08
157	0.08
158	0.08
159	0.08
160	0.07
161	0.05
162	0.05
163	0.06
164	0.07
165	0.07
166	0.08
167	0.11
168	0.11
169	0.11
170	0.12
171	0.11
172	0.11
173	0.12
174	0.12
175	0.15
176	0.21
177	0.22
178	0.25
179	0.25
180	0.25
181	0.3
182	0.29
183	0.25
184	0.21
185	0.26
186	0.24
187	0.24
188	0.25
189	0.2
190	0.24
191	0.23
192	0.21
193	0.16
194	0.14
195	0.14
196	0.16
197	0.17
198	0.13
199	0.13
200	0.13
201	0.18
202	0.18
203	0.17
204	0.15
205	0.14
206	0.15
207	0.23
208	0.25
209	0.2
210	0.2
211	0.21
212	0.21
213	0.21
214	0.25
215	0.23
216	0.23
217	0.26
218	0.29
219	0.3
220	0.3
221	0.28
222	0.26
223	0.21
224	0.17
225	0.15
226	0.11
227	0.12
228	0.12
229	0.12
230	0.09
231	0.07
232	0.08
233	0.08
234	0.07
235	0.05
236	0.05
237	0.05
238	0.05
239	0.05
240	0.05
241	0.06
242	0.08
243	0.1
244	0.12
245	0.13
246	0.16
247	0.21
248	0.24
249	0.3
250	0.34
251	0.36
252	0.37
253	0.36
254	0.32
255	0.31
256	0.27
257	0.22
258	0.18
259	0.16
260	0.15
261	0.14
262	0.13
263	0.11
264	0.1
265	0.08
266	0.08
267	0.05
268	0.05
269	0.05
270	0.05
271	0.04
272	0.04
273	0.04
274	0.03
275	0.03
276	0.04
277	0.04
278	0.05
279	0.07
280	0.09
281	0.13
282	0.14
283	0.21
284	0.21
285	0.21
286	0.21
287	0.2
288	0.21
289	0.24
290	0.24
291	0.24
292	0.23
293	0.24
294	0.24
295	0.23
296	0.21
297	0.14
298	0.14
299	0.09
300	0.13
301	0.14
302	0.15
303	0.14
304	0.15
305	0.15
306	0.15
307	0.12
308	0.08
309	0.06
310	0.05
311	0.05
312	0.04
313	0.04
314	0.03
315	0.04
316	0.04
317	0.05
318	0.04
319	0.05
320	0.07
321	0.12
322	0.14
323	0.15
324	0.16
325	0.2
326	0.24
327	0.32
328	0.38
329	0.36
330	0.35
331	0.34
332	0.34
333	0.3
334	0.26
335	0.17
336	0.1
337	0.08
338	0.08
339	0.07
340	0.07
341	0.07
342	0.07
343	0.08
344	0.07
345	0.07
346	0.07
347	0.08
348	0.08
349	0.08
350	0.08
351	0.07
352	0.07
353	0.06
354	0.06
355	0.05
356	0.05
357	0.04
358	0.04
359	0.05
360	0.07
361	0.1
362	0.12
363	0.16
364	0.17
365	0.18
366	0.18
367	0.17
368	0.16
369	0.13
370	0.13
371	0.1
372	0.1
373	0.1
374	0.1
375	0.1
376	0.1
377	0.08
378	0.07
379	0.07
380	0.07
381	0.08
382	0.08
383	0.09
384	0.1
385	0.1
386	0.1
387	0.1
388	0.11
389	0.11
390	0.1
391	0.09
392	0.08
393	0.09
394	0.1
395	0.11
396	0.11
397	0.11
398	0.1
399	0.13
400	0.12
401	0.11
402	0.11
403	0.12
404	0.1
405	0.1
406	0.09
407	0.08
408	0.08
409	0.09
410	0.09
411	0.09
412	0.09
413	0.09
414	0.09
415	0.12
416	0.19
417	0.2
418	0.29
419	0.3
420	0.33
421	0.33
422	0.35
423	0.39
424	0.34
425	0.35
426	0.27
427	0.28
428	0.29
429	0.31
430	0.29
431	0.24
432	0.24
433	0.21
434	0.19
435	0.18
436	0.16
437	0.19
438	0.21
439	0.2
440	0.21
441	0.22
442	0.23
443	0.21
444	0.21
445	0.17
446	0.17
447	0.21
448	0.19
449	0.19
450	0.18
451	0.18
452	0.16
453	0.16
454	0.13
455	0.1
456	0.12
457	0.11
458	0.1
459	0.11
460	0.11
461	0.12
462	0.13
463	0.18
464	0.19
465	0.27
466	0.31
467	0.33
468	0.34
469	0.38
470	0.44
471	0.44
472	0.44
473	0.44
474	0.42
475	0.4
476	0.39
477	0.36
478	0.3
479	0.26
480	0.26
481	0.22
482	0.22
483	0.23
484	0.23
485	0.21
486	0.21
487	0.27
488	0.26
489	0.31
490	0.36
491	0.41
492	0.45
493	0.51
494	0.53
495	0.56
496	0.57
497	0.54
498	0.55
499	0.5
500	0.47
501	0.43
502	0.4
503	0.31
504	0.27
505	0.23
506	0.15
507	0.14
508	0.15
509	0.13
510	0.14
511	0.16
512	0.16
513	0.17
514	0.16
515	0.18
516	0.24
517	0.23
518	0.22
519	0.23
520	0.25
521	0.29
522	0.33
523	0.33
524	0.3
525	0.35
526	0.38
527	0.35
528	0.37
529	0.41
530	0.43
531	0.46
532	0.42
533	0.38
534	0.38
535	0.38
536	0.37
537	0.32
538	0.26
539	0.2
540	0.22
541	0.23
542	0.22
543	0.21
544	0.18
545	0.16
546	0.2
547	0.21
548	0.19
549	0.21
550	0.25
551	0.34
552	0.4
553	0.43
554	0.44
555	0.52
556	0.59
557	0.63
558	0.63
559	0.65
560	0.6
561	0.63
562	0.64
563	0.57
564	0.51
565	0.47
566	0.4
567	0.34
568	0.33
569	0.27
570	0.21
571	0.18
572	0.17
573	0.15
574	0.15
575	0.14
576	0.18
577	0.23
578	0.26
579	0.3
580	0.32
581	0.38
582	0.4
583	0.42
584	0.45
585	0.48
586	0.53
587	0.54
588	0.56
589	0.56
590	0.6
591	0.58
592	0.59
593	0.6
594	0.6
595	0.62
596	0.69
597	0.7
598	0.68
599	0.64
600	0.57
601	0.48
602	0.44
603	0.36
604	0.27
605	0.21
606	0.23
607	0.24
608	0.21
609	0.21
610	0.21
611	0.22
612	0.28
613	0.34
614	0.37
615	0.44
616	0.55
617	0.64
618	0.69
619	0.75
620	0.78
621	0.81
622	0.82
623	0.83
624	0.79
625	0.75
626	0.7
627	0.69
628	0.69
629	0.66
630	0.63
631	0.64
632	0.61
633	0.62
634	0.68
635	0.66
636	0.63
637	0.64
638	0.67
639	0.67
640	0.7

A0A0D1EA74

3D AlphaFold-predicted Structure Viewer