Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423W482

Protein Details
Accession A0A423W482    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
77-101RDRDRRPARSPRRRSPSPRRARDYSBasic
NLS Segment(s)
PositionSequence
77-130RDRDRRPARSPRRRSPSPRRARDYSPRKDDRRERDRYDDRDRRDTRDRSRSPDR
Subcellular Location(s) nucl 14.5, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
Amino Acid Sequences MSRGGTTLYVTGFSHGTRARDLAYEFERFAFVEYEDRRDADDAYHDMHNKRLGRDDILKIEWARTPPSASWRFDSGRDRDRRPARSPRRRSPSPRRARDYSPRKDDRRERDRYDDRDRRDTRDRSRSPDRRDRDDRDRDDRDDRERRDPVANGDERKPTLDSPPAHDDLDTAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.2
4 0.2
5 0.21
6 0.21
7 0.22
8 0.23
9 0.23
10 0.24
11 0.24
12 0.23
13 0.22
14 0.22
15 0.19
16 0.2
17 0.15
18 0.12
19 0.18
20 0.19
21 0.23
22 0.23
23 0.24
24 0.23
25 0.23
26 0.23
27 0.16
28 0.18
29 0.15
30 0.16
31 0.19
32 0.21
33 0.2
34 0.23
35 0.28
36 0.27
37 0.27
38 0.3
39 0.29
40 0.31
41 0.36
42 0.36
43 0.34
44 0.33
45 0.34
46 0.28
47 0.28
48 0.25
49 0.21
50 0.19
51 0.16
52 0.17
53 0.16
54 0.24
55 0.28
56 0.27
57 0.28
58 0.3
59 0.31
60 0.33
61 0.37
62 0.34
63 0.38
64 0.42
65 0.42
66 0.47
67 0.53
68 0.55
69 0.56
70 0.62
71 0.64
72 0.7
73 0.76
74 0.76
75 0.78
76 0.8
77 0.83
78 0.83
79 0.83
80 0.83
81 0.83
82 0.8
83 0.76
84 0.75
85 0.76
86 0.75
87 0.73
88 0.72
89 0.72
90 0.69
91 0.73
92 0.75
93 0.75
94 0.74
95 0.73
96 0.69
97 0.71
98 0.75
99 0.74
100 0.76
101 0.73
102 0.69
103 0.72
104 0.68
105 0.65
106 0.66
107 0.67
108 0.65
109 0.69
110 0.67
111 0.65
112 0.73
113 0.75
114 0.75
115 0.77
116 0.74
117 0.73
118 0.77
119 0.77
120 0.77
121 0.78
122 0.76
123 0.75
124 0.74
125 0.7
126 0.69
127 0.65
128 0.65
129 0.64
130 0.61
131 0.61
132 0.58
133 0.57
134 0.55
135 0.52
136 0.49
137 0.49
138 0.51
139 0.46
140 0.47
141 0.49
142 0.44
143 0.45
144 0.41
145 0.33
146 0.33
147 0.36
148 0.34
149 0.36
150 0.42
151 0.43
152 0.41
153 0.39