Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423XDB6

Protein Details
Accession A0A423XDB6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
165-189LAKSSKFTKANEKRQKRNERVQAPSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045107  SAC3/GANP/THP3  
IPR005062  SAC3/GANP/THP3_conserved  
Pfam View protein in Pfam  
PF03399  SAC3_GANP  
Amino Acid Sequences MMGWAAVAGQAAAAAPPPPGAYSYPNPNQPEPAKKKIEWPLSVRQYVQRSFIPANLDPSVPRSDMETKLKEVISRASDSGQLLTIDWDNMPLPQQLIRGERARLLEAQKSGPSSSPGSSKKRKSFDVDHDDSSNPANAAPWQRNPLEYRVSYAENDRRKIMDEPLAKSSKFTKANEKRQKRNERVQAPSPSPEPPAGPVVGICQKLEKSYLRLTAPPKPEVVRPESVLRQTLDLLKKKWRKERNYSYICDQFKSMRQDLTVQRIKNDLTVEVYEIHARIALEMADLGEYNQCQTQLMALYKLGLKGHPDEFKAYRILYFIHTANRSALNDALADLTTAEKSEPAIKHALDVRSALALGNYHRFFQLYIDPSNIKMGAYLMDMFVGRERLAALCNICKAYKPDVKLRFITEELGFDGDSDAYQFLIDQDGQELLEERNSEYYFLTGKAKAHFEGAKVKAFGRVDIKGQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.06
4 0.07
5 0.08
6 0.1
7 0.13
8 0.18
9 0.23
10 0.32
11 0.38
12 0.45
13 0.5
14 0.49
15 0.55
16 0.56
17 0.61
18 0.6
19 0.63
20 0.63
21 0.59
22 0.67
23 0.68
24 0.71
25 0.66
26 0.65
27 0.66
28 0.67
29 0.69
30 0.63
31 0.6
32 0.58
33 0.54
34 0.52
35 0.43
36 0.41
37 0.39
38 0.39
39 0.38
40 0.33
41 0.36
42 0.33
43 0.31
44 0.26
45 0.28
46 0.29
47 0.23
48 0.21
49 0.21
50 0.25
51 0.31
52 0.39
53 0.39
54 0.38
55 0.42
56 0.42
57 0.39
58 0.35
59 0.35
60 0.31
61 0.3
62 0.29
63 0.25
64 0.27
65 0.26
66 0.25
67 0.2
68 0.16
69 0.13
70 0.14
71 0.14
72 0.12
73 0.11
74 0.11
75 0.1
76 0.1
77 0.12
78 0.11
79 0.11
80 0.12
81 0.14
82 0.17
83 0.2
84 0.25
85 0.26
86 0.26
87 0.29
88 0.29
89 0.29
90 0.29
91 0.3
92 0.3
93 0.29
94 0.3
95 0.28
96 0.28
97 0.27
98 0.24
99 0.23
100 0.21
101 0.21
102 0.26
103 0.32
104 0.39
105 0.47
106 0.55
107 0.61
108 0.64
109 0.67
110 0.66
111 0.67
112 0.69
113 0.7
114 0.65
115 0.59
116 0.56
117 0.51
118 0.45
119 0.37
120 0.28
121 0.18
122 0.13
123 0.11
124 0.13
125 0.18
126 0.21
127 0.23
128 0.26
129 0.27
130 0.3
131 0.32
132 0.33
133 0.33
134 0.29
135 0.3
136 0.28
137 0.29
138 0.27
139 0.32
140 0.35
141 0.35
142 0.36
143 0.34
144 0.32
145 0.33
146 0.34
147 0.31
148 0.32
149 0.31
150 0.32
151 0.37
152 0.39
153 0.36
154 0.35
155 0.35
156 0.35
157 0.36
158 0.35
159 0.39
160 0.47
161 0.58
162 0.68
163 0.74
164 0.75
165 0.8
166 0.89
167 0.86
168 0.86
169 0.85
170 0.82
171 0.79
172 0.77
173 0.73
174 0.64
175 0.58
176 0.5
177 0.42
178 0.35
179 0.3
180 0.22
181 0.17
182 0.17
183 0.14
184 0.12
185 0.1
186 0.12
187 0.15
188 0.15
189 0.14
190 0.13
191 0.13
192 0.14
193 0.17
194 0.16
195 0.15
196 0.18
197 0.23
198 0.22
199 0.27
200 0.29
201 0.34
202 0.36
203 0.33
204 0.32
205 0.29
206 0.31
207 0.3
208 0.32
209 0.26
210 0.24
211 0.26
212 0.27
213 0.27
214 0.26
215 0.22
216 0.18
217 0.17
218 0.21
219 0.24
220 0.25
221 0.26
222 0.33
223 0.39
224 0.44
225 0.53
226 0.57
227 0.59
228 0.67
229 0.75
230 0.77
231 0.77
232 0.73
233 0.7
234 0.68
235 0.6
236 0.5
237 0.4
238 0.32
239 0.32
240 0.35
241 0.31
242 0.24
243 0.24
244 0.29
245 0.31
246 0.38
247 0.37
248 0.31
249 0.31
250 0.31
251 0.31
252 0.27
253 0.25
254 0.17
255 0.13
256 0.14
257 0.14
258 0.12
259 0.13
260 0.11
261 0.1
262 0.09
263 0.08
264 0.08
265 0.07
266 0.06
267 0.06
268 0.05
269 0.05
270 0.05
271 0.04
272 0.04
273 0.04
274 0.05
275 0.05
276 0.06
277 0.06
278 0.06
279 0.06
280 0.06
281 0.07
282 0.1
283 0.11
284 0.11
285 0.1
286 0.12
287 0.12
288 0.14
289 0.13
290 0.11
291 0.12
292 0.14
293 0.19
294 0.21
295 0.21
296 0.24
297 0.25
298 0.27
299 0.27
300 0.24
301 0.2
302 0.17
303 0.18
304 0.15
305 0.17
306 0.16
307 0.2
308 0.2
309 0.21
310 0.22
311 0.24
312 0.22
313 0.21
314 0.2
315 0.14
316 0.14
317 0.13
318 0.12
319 0.08
320 0.08
321 0.06
322 0.07
323 0.06
324 0.06
325 0.06
326 0.05
327 0.06
328 0.13
329 0.14
330 0.16
331 0.2
332 0.19
333 0.22
334 0.28
335 0.28
336 0.23
337 0.23
338 0.2
339 0.17
340 0.18
341 0.14
342 0.09
343 0.1
344 0.11
345 0.17
346 0.17
347 0.18
348 0.18
349 0.18
350 0.18
351 0.19
352 0.24
353 0.21
354 0.22
355 0.24
356 0.25
357 0.25
358 0.28
359 0.25
360 0.17
361 0.14
362 0.13
363 0.1
364 0.11
365 0.11
366 0.08
367 0.09
368 0.09
369 0.09
370 0.1
371 0.1
372 0.09
373 0.09
374 0.09
375 0.09
376 0.11
377 0.13
378 0.14
379 0.16
380 0.19
381 0.2
382 0.2
383 0.22
384 0.25
385 0.32
386 0.35
387 0.37
388 0.45
389 0.51
390 0.56
391 0.57
392 0.57
393 0.53
394 0.48
395 0.47
396 0.38
397 0.31
398 0.27
399 0.25
400 0.2
401 0.15
402 0.15
403 0.11
404 0.1
405 0.09
406 0.08
407 0.06
408 0.06
409 0.06
410 0.06
411 0.09
412 0.09
413 0.08
414 0.09
415 0.1
416 0.1
417 0.11
418 0.12
419 0.1
420 0.12
421 0.13
422 0.13
423 0.18
424 0.18
425 0.19
426 0.17
427 0.19
428 0.18
429 0.19
430 0.22
431 0.2
432 0.23
433 0.27
434 0.3
435 0.29
436 0.33
437 0.33
438 0.32
439 0.39
440 0.39
441 0.41
442 0.39
443 0.39
444 0.4
445 0.38
446 0.4
447 0.36
448 0.35