Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423X7T5

Protein Details
Accession A0A423X7T5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPANTGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
8-23AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 9cyto 9cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPANTGAKKQKKKWSKGKVKDKAQHAVILDKATSDKLNKDVQSYRLVTVATLVDRLKINGSLARKCLADLEERGQIRPIVTHSKMKIYTRAVGGAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.89
4 0.9
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.48
15 0.39
16 0.32
17 0.25
18 0.18
19 0.16
20 0.14
21 0.14
22 0.12
23 0.12
24 0.15
25 0.2
26 0.2
27 0.23
28 0.25
29 0.26
30 0.3
31 0.3
32 0.27
33 0.23
34 0.22
35 0.18
36 0.16
37 0.14
38 0.09
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.1
47 0.12
48 0.16
49 0.17
50 0.18
51 0.2
52 0.19
53 0.18
54 0.2
55 0.17
56 0.18
57 0.18
58 0.2
59 0.25
60 0.25
61 0.26
62 0.25
63 0.25
64 0.21
65 0.2
66 0.21
67 0.23
68 0.26
69 0.33
70 0.33
71 0.4
72 0.45
73 0.47
74 0.5
75 0.46
76 0.48
77 0.43