Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423XCZ5

Protein Details
Accession A0A423XCZ5    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
461-482RSLWRWGAKKVQKEEKKVPMSHHydrophilic
NLS Segment(s)
PositionSequence
166-176KVRRKRRAQEK
Subcellular Location(s) mito 14.5, cyto_mito 9, nucl 8, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021056  Mt_import_IM_translocase_Tim54  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF11711  Tim54  
Amino Acid Sequences MAEPTPPVTAAAGAAPATAATTTTTTAATPKPAAPAPPKPPQQNPALRMMGLPALPRKLPSRNWMIFWTLSTTLAAAIIYDRREKRRATARWAHAVEHLATVPLPNPSALPRKLTIYLAAPPGDGLRIAQDHYAEYVKPVLAASGLDWEFVQGRMQGDIRAAVAEKVRRKRRAQEKDIGGAKKQSSNPVVAAAEEHLLTEEDRLEAFRRAAGIPEYDGVRGDIVVGRHAWKEYVRGLHEGWLGPLEAPPSAQPDPEPKPSSTEEGEESNSNKPKRPPQIKPYNSPEDYATAQLPFLVPAELGPSAPVEFPHILGFLNTPTRFYRFLTRRRLADQIGRDVAAACLASYREFQQETSADASQDYQWEQQKVLLHEEKSWQKSVWKSDDEDAKKKTTEADEAGSEPSPTPVQKKEKIWPKPIVMDPRLAMRMRRFELQPEDEQRAREVVVREEEIEGFIKGSLRSLWRWGAKKVQKEEKKVPMSHDDEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.07
5 0.06
6 0.06
7 0.06
8 0.08
9 0.09
10 0.1
11 0.11
12 0.11
13 0.14
14 0.16
15 0.19
16 0.2
17 0.21
18 0.25
19 0.27
20 0.33
21 0.37
22 0.45
23 0.48
24 0.55
25 0.61
26 0.64
27 0.69
28 0.68
29 0.7
30 0.7
31 0.66
32 0.65
33 0.59
34 0.52
35 0.45
36 0.41
37 0.34
38 0.26
39 0.26
40 0.22
41 0.22
42 0.23
43 0.25
44 0.29
45 0.33
46 0.37
47 0.4
48 0.46
49 0.47
50 0.49
51 0.5
52 0.49
53 0.42
54 0.38
55 0.36
56 0.27
57 0.24
58 0.21
59 0.18
60 0.14
61 0.13
62 0.12
63 0.06
64 0.07
65 0.1
66 0.12
67 0.19
68 0.24
69 0.3
70 0.35
71 0.37
72 0.43
73 0.51
74 0.56
75 0.58
76 0.64
77 0.65
78 0.7
79 0.7
80 0.63
81 0.55
82 0.52
83 0.42
84 0.34
85 0.27
86 0.17
87 0.15
88 0.14
89 0.12
90 0.11
91 0.1
92 0.08
93 0.09
94 0.14
95 0.22
96 0.23
97 0.26
98 0.26
99 0.29
100 0.31
101 0.31
102 0.29
103 0.23
104 0.26
105 0.25
106 0.24
107 0.2
108 0.18
109 0.17
110 0.15
111 0.12
112 0.08
113 0.08
114 0.08
115 0.09
116 0.1
117 0.1
118 0.11
119 0.13
120 0.14
121 0.11
122 0.11
123 0.12
124 0.11
125 0.11
126 0.1
127 0.08
128 0.07
129 0.07
130 0.07
131 0.11
132 0.11
133 0.11
134 0.11
135 0.11
136 0.11
137 0.12
138 0.12
139 0.08
140 0.09
141 0.1
142 0.11
143 0.11
144 0.11
145 0.11
146 0.1
147 0.09
148 0.09
149 0.09
150 0.12
151 0.16
152 0.23
153 0.32
154 0.41
155 0.48
156 0.52
157 0.61
158 0.69
159 0.75
160 0.75
161 0.75
162 0.72
163 0.72
164 0.74
165 0.66
166 0.56
167 0.49
168 0.43
169 0.39
170 0.36
171 0.34
172 0.29
173 0.29
174 0.28
175 0.26
176 0.24
177 0.18
178 0.17
179 0.12
180 0.11
181 0.09
182 0.08
183 0.06
184 0.06
185 0.06
186 0.06
187 0.06
188 0.05
189 0.05
190 0.06
191 0.08
192 0.09
193 0.09
194 0.09
195 0.1
196 0.1
197 0.12
198 0.12
199 0.11
200 0.1
201 0.11
202 0.11
203 0.09
204 0.09
205 0.08
206 0.07
207 0.06
208 0.06
209 0.07
210 0.06
211 0.07
212 0.07
213 0.09
214 0.09
215 0.09
216 0.1
217 0.09
218 0.11
219 0.13
220 0.16
221 0.17
222 0.18
223 0.18
224 0.2
225 0.21
226 0.19
227 0.16
228 0.12
229 0.11
230 0.09
231 0.09
232 0.07
233 0.05
234 0.05
235 0.06
236 0.1
237 0.1
238 0.1
239 0.1
240 0.16
241 0.2
242 0.27
243 0.29
244 0.25
245 0.29
246 0.3
247 0.33
248 0.28
249 0.25
250 0.2
251 0.19
252 0.2
253 0.17
254 0.18
255 0.2
256 0.25
257 0.24
258 0.27
259 0.29
260 0.37
261 0.46
262 0.53
263 0.56
264 0.61
265 0.71
266 0.72
267 0.76
268 0.75
269 0.74
270 0.65
271 0.58
272 0.48
273 0.4
274 0.35
275 0.29
276 0.22
277 0.13
278 0.12
279 0.11
280 0.1
281 0.08
282 0.07
283 0.05
284 0.05
285 0.04
286 0.06
287 0.06
288 0.06
289 0.06
290 0.06
291 0.07
292 0.07
293 0.07
294 0.09
295 0.09
296 0.1
297 0.1
298 0.1
299 0.09
300 0.1
301 0.1
302 0.08
303 0.15
304 0.14
305 0.16
306 0.17
307 0.2
308 0.21
309 0.22
310 0.31
311 0.32
312 0.41
313 0.5
314 0.53
315 0.54
316 0.56
317 0.59
318 0.52
319 0.51
320 0.46
321 0.42
322 0.38
323 0.35
324 0.32
325 0.27
326 0.24
327 0.17
328 0.13
329 0.06
330 0.06
331 0.06
332 0.07
333 0.08
334 0.1
335 0.13
336 0.14
337 0.14
338 0.18
339 0.18
340 0.19
341 0.22
342 0.21
343 0.17
344 0.17
345 0.18
346 0.14
347 0.15
348 0.15
349 0.16
350 0.2
351 0.21
352 0.21
353 0.23
354 0.27
355 0.28
356 0.34
357 0.34
358 0.3
359 0.32
360 0.39
361 0.43
362 0.42
363 0.43
364 0.36
365 0.36
366 0.41
367 0.47
368 0.47
369 0.43
370 0.42
371 0.46
372 0.54
373 0.56
374 0.57
375 0.52
376 0.49
377 0.46
378 0.43
379 0.42
380 0.36
381 0.35
382 0.3
383 0.3
384 0.28
385 0.28
386 0.3
387 0.25
388 0.22
389 0.17
390 0.16
391 0.15
392 0.15
393 0.19
394 0.25
395 0.34
396 0.4
397 0.46
398 0.54
399 0.62
400 0.69
401 0.73
402 0.73
403 0.69
404 0.7
405 0.72
406 0.72
407 0.64
408 0.59
409 0.51
410 0.49
411 0.49
412 0.42
413 0.4
414 0.37
415 0.44
416 0.43
417 0.47
418 0.43
419 0.45
420 0.52
421 0.53
422 0.54
423 0.51
424 0.55
425 0.52
426 0.51
427 0.46
428 0.39
429 0.34
430 0.31
431 0.28
432 0.26
433 0.29
434 0.29
435 0.29
436 0.29
437 0.28
438 0.25
439 0.24
440 0.18
441 0.14
442 0.13
443 0.14
444 0.12
445 0.13
446 0.16
447 0.18
448 0.21
449 0.25
450 0.33
451 0.39
452 0.43
453 0.47
454 0.54
455 0.58
456 0.65
457 0.7
458 0.73
459 0.73
460 0.78
461 0.83
462 0.82
463 0.84
464 0.78
465 0.74
466 0.73