Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423XNG3

Protein Details
Accession A0A423XNG3   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
251-274NGVDGERKTKRKRKVACGPRGSQPBasic
NLS Segment(s)
PositionSequence
257-264RKTKRKRK
Subcellular Location(s) extr 12, mito 6, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029062  Class_I_gatase-like  
Amino Acid Sequences MLRSPPRGYGGKNAAALVDLSRIVPAPLGLDTIRAEDGGESVSEMSEMARKHLHIGVYIPSPSGAQLLDTACVDILAMMSHQYLSDLAGLPERLTSLAPDVTISYIGAGGTTTTARDDKQEEDPAAAPAADTKSTNTPESNTDLDPVHLTAGMRVQLTHHTSSPAVAPGKLDAVLVPGPDPRDAWTEDSLSWLRAQAAAGGTHILSVCTGIFICGAAGLLGGGEEEEEENNNNNNNNSNSNDNDGGNGDGNGVDGERKTKRKRKVACGPRGSQPELRRLYPGCDFVGDQVRWVRDGNLWSSGGVTNGNDMVAAYCRAESGRFPGPVVEVVLGMADVKGSNRRMPYRKGYGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.33
3 0.31
4 0.22
5 0.16
6 0.11
7 0.1
8 0.1
9 0.1
10 0.1
11 0.1
12 0.09
13 0.08
14 0.08
15 0.1
16 0.1
17 0.12
18 0.12
19 0.14
20 0.14
21 0.12
22 0.12
23 0.1
24 0.1
25 0.09
26 0.09
27 0.07
28 0.07
29 0.07
30 0.06
31 0.06
32 0.06
33 0.09
34 0.09
35 0.12
36 0.14
37 0.15
38 0.18
39 0.21
40 0.22
41 0.19
42 0.21
43 0.22
44 0.23
45 0.23
46 0.2
47 0.17
48 0.16
49 0.15
50 0.14
51 0.1
52 0.07
53 0.09
54 0.1
55 0.11
56 0.11
57 0.11
58 0.09
59 0.09
60 0.08
61 0.05
62 0.05
63 0.04
64 0.04
65 0.04
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.06
72 0.08
73 0.08
74 0.08
75 0.1
76 0.1
77 0.1
78 0.1
79 0.1
80 0.08
81 0.08
82 0.08
83 0.09
84 0.09
85 0.09
86 0.09
87 0.09
88 0.09
89 0.09
90 0.08
91 0.06
92 0.06
93 0.05
94 0.05
95 0.04
96 0.04
97 0.04
98 0.05
99 0.05
100 0.06
101 0.07
102 0.08
103 0.1
104 0.13
105 0.15
106 0.2
107 0.24
108 0.23
109 0.24
110 0.24
111 0.22
112 0.2
113 0.17
114 0.12
115 0.09
116 0.1
117 0.09
118 0.09
119 0.1
120 0.14
121 0.16
122 0.18
123 0.17
124 0.17
125 0.19
126 0.22
127 0.23
128 0.18
129 0.18
130 0.17
131 0.17
132 0.16
133 0.14
134 0.1
135 0.08
136 0.08
137 0.07
138 0.08
139 0.09
140 0.08
141 0.08
142 0.09
143 0.12
144 0.15
145 0.16
146 0.15
147 0.15
148 0.15
149 0.16
150 0.16
151 0.15
152 0.13
153 0.11
154 0.11
155 0.1
156 0.11
157 0.1
158 0.09
159 0.05
160 0.07
161 0.07
162 0.07
163 0.07
164 0.07
165 0.08
166 0.08
167 0.08
168 0.08
169 0.1
170 0.12
171 0.14
172 0.14
173 0.15
174 0.14
175 0.18
176 0.17
177 0.14
178 0.13
179 0.11
180 0.1
181 0.1
182 0.1
183 0.08
184 0.08
185 0.08
186 0.08
187 0.08
188 0.07
189 0.07
190 0.07
191 0.05
192 0.04
193 0.04
194 0.04
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.04
201 0.03
202 0.03
203 0.03
204 0.03
205 0.02
206 0.02
207 0.02
208 0.02
209 0.02
210 0.02
211 0.02
212 0.03
213 0.03
214 0.04
215 0.05
216 0.07
217 0.08
218 0.1
219 0.11
220 0.11
221 0.15
222 0.16
223 0.18
224 0.19
225 0.21
226 0.21
227 0.23
228 0.25
229 0.21
230 0.2
231 0.18
232 0.17
233 0.14
234 0.13
235 0.09
236 0.07
237 0.08
238 0.07
239 0.06
240 0.06
241 0.05
242 0.1
243 0.16
244 0.25
245 0.35
246 0.44
247 0.53
248 0.63
249 0.72
250 0.77
251 0.83
252 0.85
253 0.86
254 0.86
255 0.8
256 0.79
257 0.76
258 0.69
259 0.65
260 0.58
261 0.57
262 0.53
263 0.5
264 0.46
265 0.41
266 0.41
267 0.38
268 0.37
269 0.29
270 0.26
271 0.25
272 0.24
273 0.32
274 0.27
275 0.25
276 0.27
277 0.27
278 0.26
279 0.27
280 0.25
281 0.2
282 0.23
283 0.23
284 0.23
285 0.23
286 0.21
287 0.22
288 0.21
289 0.18
290 0.16
291 0.13
292 0.11
293 0.11
294 0.11
295 0.09
296 0.08
297 0.09
298 0.09
299 0.1
300 0.09
301 0.09
302 0.1
303 0.11
304 0.12
305 0.12
306 0.16
307 0.22
308 0.23
309 0.23
310 0.24
311 0.25
312 0.26
313 0.26
314 0.2
315 0.13
316 0.12
317 0.12
318 0.1
319 0.08
320 0.06
321 0.05
322 0.05
323 0.07
324 0.14
325 0.17
326 0.22
327 0.3
328 0.39
329 0.46
330 0.54
331 0.62