Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423XGX1

Protein Details
Accession A0A423XGX1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGKRKKSSRKPMGKKRNDPLPTVBasic
NLS Segment(s)
PositionSequence
3-16KRKKSSRKPMGKKR
Subcellular Location(s) mito 10cyto 10cyto_mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPMGKKRNDPLPTVFTCLFCNHENSVTVKIDKKAGIGSLECKVCGQRFQCTINYLSAAVDVYGEWVDAAEAVAKGEGEGEGMTTTERQYAGEPSRVTRKDRNTANDSDGEPEYSGEGIVGDDEDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.92
3 0.91
4 0.83
5 0.77
6 0.71
7 0.67
8 0.58
9 0.54
10 0.47
11 0.37
12 0.36
13 0.33
14 0.3
15 0.24
16 0.26
17 0.21
18 0.22
19 0.23
20 0.23
21 0.26
22 0.24
23 0.25
24 0.25
25 0.24
26 0.26
27 0.24
28 0.23
29 0.19
30 0.18
31 0.18
32 0.15
33 0.16
34 0.18
35 0.18
36 0.17
37 0.16
38 0.16
39 0.15
40 0.19
41 0.18
42 0.19
43 0.22
44 0.25
45 0.27
46 0.27
47 0.28
48 0.23
49 0.22
50 0.17
51 0.14
52 0.11
53 0.09
54 0.06
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.03
74 0.03
75 0.04
76 0.04
77 0.04
78 0.05
79 0.05
80 0.05
81 0.07
82 0.07
83 0.07
84 0.09
85 0.15
86 0.18
87 0.23
88 0.23
89 0.25
90 0.35
91 0.37
92 0.42
93 0.44
94 0.49
95 0.52
96 0.59
97 0.63
98 0.6
99 0.61
100 0.59
101 0.55
102 0.48
103 0.43
104 0.37
105 0.3
106 0.25
107 0.21
108 0.17
109 0.14
110 0.12
111 0.08
112 0.07
113 0.06
114 0.06