Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423XBZ9

Protein Details
Accession A0A423XBZ9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
91-122VHSSIKKRCEHCKIVRRKKSKRGNGYRYVICSHydrophilic
NLS Segment(s)
PositionSequence
106-112RRKKSKR
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MASRLSIARCMRSSSSISGLANSLRALSVNSASRPTIATATVVQTQAQTQTRALSTVLTPRFGPSVISARNTFAGPAAVSAVVQQTRGMKVHSSIKKRCEHCKIVRRKKSKRGNGYRYVICSANPRHKQRQGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.32
4 0.31
5 0.27
6 0.26
7 0.22
8 0.2
9 0.16
10 0.13
11 0.09
12 0.09
13 0.09
14 0.09
15 0.12
16 0.14
17 0.15
18 0.17
19 0.17
20 0.17
21 0.17
22 0.17
23 0.14
24 0.12
25 0.12
26 0.11
27 0.14
28 0.15
29 0.15
30 0.14
31 0.13
32 0.13
33 0.16
34 0.17
35 0.16
36 0.14
37 0.15
38 0.15
39 0.16
40 0.15
41 0.11
42 0.1
43 0.16
44 0.16
45 0.15
46 0.15
47 0.15
48 0.16
49 0.15
50 0.14
51 0.09
52 0.14
53 0.14
54 0.16
55 0.16
56 0.17
57 0.18
58 0.17
59 0.15
60 0.1
61 0.09
62 0.07
63 0.06
64 0.06
65 0.05
66 0.05
67 0.05
68 0.07
69 0.06
70 0.07
71 0.08
72 0.09
73 0.11
74 0.12
75 0.12
76 0.11
77 0.15
78 0.24
79 0.31
80 0.38
81 0.42
82 0.49
83 0.56
84 0.6
85 0.66
86 0.66
87 0.68
88 0.7
89 0.74
90 0.78
91 0.81
92 0.86
93 0.88
94 0.89
95 0.9
96 0.91
97 0.91
98 0.91
99 0.91
100 0.9
101 0.9
102 0.87
103 0.82
104 0.75
105 0.68
106 0.57
107 0.48
108 0.46
109 0.45
110 0.48
111 0.52
112 0.56
113 0.63