Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423XBI9

Protein Details
Accession A0A423XBI9    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-41TTTKPARHGLFRRKVRQHPQHTHPHTBasic
NLS Segment(s)
PositionSequence
45-47KRK
56-62GGLKKLK
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 7, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MARRTANNTTTTTTTTTTKPARHGLFRRKVRQHPQHTHPHTHHQKRKTTIGDKIAGGLKKLKGTITRNPAVKAAGTRRMHGTDGRGSHRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.3
4 0.32
5 0.32
6 0.35
7 0.4
8 0.42
9 0.48
10 0.56
11 0.59
12 0.64
13 0.7
14 0.75
15 0.76
16 0.81
17 0.82
18 0.84
19 0.84
20 0.82
21 0.8
22 0.82
23 0.78
24 0.77
25 0.69
26 0.69
27 0.69
28 0.7
29 0.7
30 0.66
31 0.68
32 0.64
33 0.68
34 0.65
35 0.59
36 0.55
37 0.53
38 0.49
39 0.42
40 0.4
41 0.37
42 0.3
43 0.26
44 0.24
45 0.2
46 0.19
47 0.2
48 0.2
49 0.23
50 0.28
51 0.35
52 0.4
53 0.44
54 0.45
55 0.46
56 0.45
57 0.39
58 0.36
59 0.34
60 0.32
61 0.36
62 0.35
63 0.36
64 0.39
65 0.4
66 0.41
67 0.37
68 0.36
69 0.34
70 0.38