Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423WDR7

Protein Details
Accession A0A423WDR7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
53-75ITWTYFSRKKKVRKGRYPGGPKPHydrophilic
NLS Segment(s)
PositionSequence
60-73RKKKVRKGRYPGGP
119-126GGHRRPPR
Subcellular Location(s) plas 9, extr 9, E.R. 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000612  PMP3  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01679  Pmp3  
Amino Acid Sequences MGIFLERCMLTLVNVFLPPLSVMLVAGVGRDALVNTLWFLCGVIPGHIHGFYITWTYFSRKKKVRKGRYPGGPKPLIYSPRVINGDASPQRVRQLYLAEQRAKEEGLMRKQSSQRGASGGHRRPPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.11
4 0.12
5 0.11
6 0.09
7 0.08
8 0.06
9 0.06
10 0.06
11 0.07
12 0.06
13 0.05
14 0.05
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.05
21 0.05
22 0.05
23 0.06
24 0.06
25 0.06
26 0.06
27 0.05
28 0.06
29 0.07
30 0.07
31 0.07
32 0.08
33 0.09
34 0.09
35 0.09
36 0.07
37 0.07
38 0.06
39 0.08
40 0.07
41 0.08
42 0.09
43 0.13
44 0.19
45 0.23
46 0.31
47 0.37
48 0.46
49 0.55
50 0.65
51 0.72
52 0.76
53 0.81
54 0.82
55 0.84
56 0.85
57 0.8
58 0.77
59 0.69
60 0.58
61 0.53
62 0.49
63 0.42
64 0.34
65 0.32
66 0.24
67 0.29
68 0.3
69 0.27
70 0.23
71 0.2
72 0.28
73 0.27
74 0.3
75 0.25
76 0.24
77 0.28
78 0.27
79 0.28
80 0.21
81 0.23
82 0.26
83 0.33
84 0.4
85 0.41
86 0.41
87 0.41
88 0.41
89 0.36
90 0.3
91 0.28
92 0.29
93 0.33
94 0.4
95 0.4
96 0.46
97 0.5
98 0.56
99 0.56
100 0.51
101 0.45
102 0.41
103 0.43
104 0.44
105 0.5
106 0.51