Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423VMQ9

Protein Details
Accession A0A423VMQ9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
55-79GLCLWPIGKRVRRHYHKKIDRAGDVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MANRTDQWIHMQAQAVNNTGPSNSTYTSQPPGGIGGYVHSYVLIAVAVAILLVLGLCLWPIGKRVRRHYHKKIDRAGDVAVSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.28
3 0.24
4 0.22
5 0.2
6 0.17
7 0.15
8 0.11
9 0.12
10 0.12
11 0.13
12 0.14
13 0.17
14 0.2
15 0.2
16 0.18
17 0.16
18 0.16
19 0.14
20 0.12
21 0.09
22 0.07
23 0.08
24 0.08
25 0.07
26 0.06
27 0.06
28 0.05
29 0.05
30 0.04
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.01
38 0.01
39 0.01
40 0.01
41 0.01
42 0.01
43 0.02
44 0.02
45 0.02
46 0.03
47 0.07
48 0.16
49 0.23
50 0.31
51 0.41
52 0.52
53 0.62
54 0.73
55 0.8
56 0.83
57 0.86
58 0.88
59 0.87
60 0.85
61 0.78
62 0.71
63 0.61