Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423XGM1

Protein Details
Accession A0A423XGM1   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
409-439AATQRVRGARVRKDRRPRRRRRTEVELTMFHBasic
NLS Segment(s)
PositionSequence
414-430VRGARVRKDRRPRRRRR
Subcellular Location(s) mito 11, nucl 10, cyto_nucl 9.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MLSHLVKIPRALRALPHSTCEDQDCSRLQGTVPGLDTAGAAGTGPDETTGLTTAHMPSPPPSRVFSVRVPSTSPPSSAGSSSSASCSSSPGQPDNPGGVVTTTTTKSHTAPHTRADGRVFTVRVPSTSPPSSAGYPSSASSSSSGLPAVQIGGLTTTAAPEAPPHRAGHDGDGDGHPMVVTASAATGSSSLAAPSGYGLPEQWEAHRRLADAVFAYKVVSLTSHLRNGSSSNVPDTPALEGLLSGRLEVFADERECNAKEQSDGASVIHVGRVDDVSQQQSRSEQQRKQEQQRQQEQLPTPAESRAKHRVRQVFAETWIGKCFHSSESVTPEQAKEDDNTLDIPSDSEEPNPVGAHDSADNHHHQQPHRDTPHQPSPPLGRTSQPQPQPHDAPEQPAPPPDGVHDIAAAATQRVRGARVRKDRRPRRRRRTEVELTMFHAIRWLGMGDVVPNVSVVTGGPLVRMPLPCTFGDGPSGRKGKEEDYFGVVLARKLVRYVEKRRAERVRGMGKGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.44
3 0.45
4 0.45
5 0.44
6 0.45
7 0.43
8 0.39
9 0.32
10 0.35
11 0.34
12 0.32
13 0.31
14 0.29
15 0.25
16 0.27
17 0.27
18 0.26
19 0.25
20 0.22
21 0.21
22 0.2
23 0.2
24 0.13
25 0.11
26 0.07
27 0.05
28 0.04
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.07
36 0.08
37 0.08
38 0.08
39 0.1
40 0.12
41 0.15
42 0.16
43 0.16
44 0.19
45 0.26
46 0.29
47 0.3
48 0.31
49 0.34
50 0.38
51 0.41
52 0.43
53 0.45
54 0.45
55 0.44
56 0.45
57 0.43
58 0.45
59 0.42
60 0.37
61 0.31
62 0.31
63 0.31
64 0.28
65 0.26
66 0.22
67 0.22
68 0.21
69 0.2
70 0.18
71 0.17
72 0.17
73 0.18
74 0.18
75 0.2
76 0.23
77 0.25
78 0.27
79 0.29
80 0.31
81 0.29
82 0.27
83 0.23
84 0.2
85 0.16
86 0.14
87 0.12
88 0.13
89 0.13
90 0.13
91 0.15
92 0.17
93 0.17
94 0.24
95 0.31
96 0.36
97 0.37
98 0.41
99 0.48
100 0.47
101 0.49
102 0.46
103 0.4
104 0.35
105 0.37
106 0.33
107 0.25
108 0.29
109 0.27
110 0.25
111 0.26
112 0.25
113 0.27
114 0.27
115 0.28
116 0.25
117 0.27
118 0.28
119 0.26
120 0.25
121 0.2
122 0.19
123 0.19
124 0.18
125 0.15
126 0.15
127 0.14
128 0.14
129 0.13
130 0.12
131 0.12
132 0.09
133 0.09
134 0.08
135 0.07
136 0.06
137 0.05
138 0.04
139 0.05
140 0.05
141 0.05
142 0.05
143 0.04
144 0.04
145 0.05
146 0.04
147 0.07
148 0.09
149 0.13
150 0.15
151 0.15
152 0.17
153 0.2
154 0.21
155 0.21
156 0.22
157 0.19
158 0.19
159 0.19
160 0.19
161 0.16
162 0.15
163 0.11
164 0.08
165 0.07
166 0.05
167 0.04
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.05
182 0.06
183 0.05
184 0.05
185 0.05
186 0.07
187 0.09
188 0.1
189 0.12
190 0.17
191 0.19
192 0.22
193 0.23
194 0.21
195 0.21
196 0.21
197 0.2
198 0.15
199 0.14
200 0.11
201 0.1
202 0.1
203 0.08
204 0.08
205 0.07
206 0.06
207 0.07
208 0.11
209 0.13
210 0.16
211 0.16
212 0.16
213 0.17
214 0.18
215 0.19
216 0.17
217 0.16
218 0.15
219 0.15
220 0.16
221 0.16
222 0.15
223 0.13
224 0.1
225 0.1
226 0.07
227 0.06
228 0.06
229 0.08
230 0.07
231 0.06
232 0.06
233 0.05
234 0.06
235 0.06
236 0.06
237 0.05
238 0.07
239 0.07
240 0.08
241 0.1
242 0.11
243 0.12
244 0.12
245 0.11
246 0.1
247 0.11
248 0.11
249 0.11
250 0.11
251 0.09
252 0.09
253 0.09
254 0.08
255 0.08
256 0.07
257 0.05
258 0.05
259 0.06
260 0.06
261 0.07
262 0.09
263 0.11
264 0.12
265 0.13
266 0.13
267 0.14
268 0.18
269 0.26
270 0.32
271 0.32
272 0.39
273 0.49
274 0.57
275 0.65
276 0.69
277 0.68
278 0.7
279 0.75
280 0.73
281 0.65
282 0.64
283 0.56
284 0.53
285 0.48
286 0.39
287 0.31
288 0.3
289 0.31
290 0.25
291 0.29
292 0.33
293 0.36
294 0.38
295 0.45
296 0.49
297 0.49
298 0.53
299 0.52
300 0.45
301 0.42
302 0.45
303 0.38
304 0.31
305 0.3
306 0.26
307 0.2
308 0.18
309 0.17
310 0.12
311 0.15
312 0.15
313 0.16
314 0.22
315 0.23
316 0.24
317 0.23
318 0.22
319 0.2
320 0.2
321 0.19
322 0.13
323 0.14
324 0.13
325 0.13
326 0.13
327 0.12
328 0.12
329 0.1
330 0.09
331 0.08
332 0.1
333 0.1
334 0.1
335 0.11
336 0.11
337 0.12
338 0.11
339 0.1
340 0.11
341 0.1
342 0.11
343 0.11
344 0.12
345 0.13
346 0.16
347 0.19
348 0.2
349 0.24
350 0.27
351 0.28
352 0.36
353 0.42
354 0.49
355 0.51
356 0.52
357 0.53
358 0.57
359 0.65
360 0.6
361 0.53
362 0.47
363 0.49
364 0.5
365 0.49
366 0.42
367 0.34
368 0.34
369 0.4
370 0.43
371 0.44
372 0.44
373 0.48
374 0.53
375 0.55
376 0.53
377 0.55
378 0.48
379 0.46
380 0.44
381 0.4
382 0.34
383 0.33
384 0.32
385 0.24
386 0.24
387 0.2
388 0.21
389 0.19
390 0.18
391 0.16
392 0.14
393 0.13
394 0.13
395 0.12
396 0.08
397 0.07
398 0.08
399 0.1
400 0.1
401 0.13
402 0.19
403 0.26
404 0.36
405 0.46
406 0.56
407 0.64
408 0.74
409 0.83
410 0.88
411 0.92
412 0.93
413 0.93
414 0.95
415 0.95
416 0.93
417 0.92
418 0.91
419 0.9
420 0.86
421 0.77
422 0.69
423 0.64
424 0.55
425 0.44
426 0.36
427 0.26
428 0.19
429 0.17
430 0.14
431 0.08
432 0.09
433 0.09
434 0.07
435 0.09
436 0.09
437 0.08
438 0.07
439 0.07
440 0.06
441 0.06
442 0.05
443 0.06
444 0.08
445 0.08
446 0.09
447 0.1
448 0.12
449 0.15
450 0.16
451 0.17
452 0.18
453 0.22
454 0.21
455 0.28
456 0.27
457 0.25
458 0.3
459 0.3
460 0.31
461 0.36
462 0.41
463 0.34
464 0.36
465 0.38
466 0.37
467 0.41
468 0.42
469 0.37
470 0.38
471 0.38
472 0.34
473 0.36
474 0.31
475 0.26
476 0.25
477 0.24
478 0.19
479 0.2
480 0.25
481 0.3
482 0.38
483 0.47
484 0.52
485 0.6
486 0.65
487 0.74
488 0.79
489 0.77
490 0.76
491 0.77
492 0.76