Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423XGL4

Protein Details
Accession A0A423XGL4   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
179-201QQEQQPHRERRRNASRRPDYYDKHydrophilic
NLS Segment(s)
PositionSequence
29-80KKRKGFRVGPENLPDGAWRRKNTKIKHDLIHKAKLKKEYAKVKAEVLKEKEK
187-258ERRRNASRRPDYYDKALKEGSKKKAEAEARAAEHKRREEERERRTAERERMRRAMLKAKGATTHGRNAGKQK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.833, mito_nucl 10.666, cyto 6
Family & Domain DBs
Amino Acid Sequences MGSKRPHDDVDAGAAPAPASSTTNAPDAKKRKGFRVGPENLPDGAWRRKNTKIKHDLIHKAKLKKEYAKVKAEVLKEKEKKQVATTAEDGDGAATTTTTTTAEASAAEAEVPSVADDKPQEPADPAQDRAHMNPARQALLNGEPIPRPTAVETVDVTAAATRQKQRLEGEDPSAAGQQQQEQQPHRERRRNASRRPDYYDKALKEGSKKKAEAEARAAEHKRREEERERRTAERERMRRAMLKAKGATTHGRNAGKQKLGRESFVLLDKVKRMVGNRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.19
3 0.16
4 0.15
5 0.09
6 0.09
7 0.1
8 0.11
9 0.13
10 0.19
11 0.22
12 0.24
13 0.33
14 0.38
15 0.46
16 0.53
17 0.55
18 0.58
19 0.65
20 0.69
21 0.7
22 0.74
23 0.7
24 0.69
25 0.7
26 0.64
27 0.54
28 0.47
29 0.39
30 0.34
31 0.37
32 0.36
33 0.36
34 0.38
35 0.47
36 0.56
37 0.62
38 0.67
39 0.68
40 0.69
41 0.72
42 0.77
43 0.77
44 0.75
45 0.77
46 0.73
47 0.7
48 0.68
49 0.68
50 0.66
51 0.64
52 0.66
53 0.66
54 0.67
55 0.67
56 0.64
57 0.62
58 0.61
59 0.58
60 0.57
61 0.52
62 0.55
63 0.53
64 0.55
65 0.57
66 0.56
67 0.53
68 0.48
69 0.49
70 0.41
71 0.4
72 0.38
73 0.32
74 0.28
75 0.26
76 0.23
77 0.16
78 0.13
79 0.08
80 0.06
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.05
87 0.05
88 0.05
89 0.06
90 0.05
91 0.06
92 0.06
93 0.05
94 0.05
95 0.04
96 0.04
97 0.04
98 0.04
99 0.03
100 0.04
101 0.04
102 0.06
103 0.07
104 0.07
105 0.11
106 0.11
107 0.11
108 0.11
109 0.13
110 0.18
111 0.19
112 0.21
113 0.19
114 0.22
115 0.22
116 0.22
117 0.29
118 0.24
119 0.23
120 0.24
121 0.24
122 0.22
123 0.21
124 0.21
125 0.14
126 0.15
127 0.16
128 0.13
129 0.13
130 0.12
131 0.13
132 0.14
133 0.12
134 0.1
135 0.09
136 0.11
137 0.11
138 0.12
139 0.12
140 0.11
141 0.11
142 0.11
143 0.09
144 0.08
145 0.07
146 0.07
147 0.1
148 0.12
149 0.15
150 0.16
151 0.2
152 0.21
153 0.26
154 0.3
155 0.29
156 0.29
157 0.26
158 0.26
159 0.24
160 0.22
161 0.17
162 0.13
163 0.11
164 0.11
165 0.15
166 0.19
167 0.23
168 0.25
169 0.33
170 0.41
171 0.51
172 0.58
173 0.62
174 0.62
175 0.68
176 0.76
177 0.79
178 0.79
179 0.8
180 0.8
181 0.78
182 0.82
183 0.79
184 0.71
185 0.69
186 0.68
187 0.58
188 0.52
189 0.49
190 0.44
191 0.45
192 0.5
193 0.5
194 0.5
195 0.49
196 0.48
197 0.53
198 0.54
199 0.51
200 0.49
201 0.46
202 0.42
203 0.49
204 0.49
205 0.46
206 0.48
207 0.48
208 0.47
209 0.46
210 0.51
211 0.54
212 0.62
213 0.66
214 0.7
215 0.7
216 0.67
217 0.69
218 0.7
219 0.69
220 0.7
221 0.69
222 0.67
223 0.68
224 0.69
225 0.68
226 0.65
227 0.65
228 0.6
229 0.6
230 0.55
231 0.52
232 0.5
233 0.48
234 0.49
235 0.44
236 0.46
237 0.45
238 0.46
239 0.47
240 0.51
241 0.55
242 0.56
243 0.55
244 0.54
245 0.56
246 0.56
247 0.54
248 0.5
249 0.44
250 0.4
251 0.41
252 0.39
253 0.3
254 0.31
255 0.32
256 0.31
257 0.31
258 0.31