Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423XED1

Protein Details
Accession A0A423XED1    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AKSKNSSQHNQSKKAHRNGIKKPKTNRYPSLHydrophilic
NLS Segment(s)
PositionSequence
14-44KKAHRNGIKKPKTNRYPSLKGTDPKFRRNHR
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSKKAHRNGIKKPKTNRYPSLKGTDPKFRRNHRYALHGTTRALKEKAEGKRETV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.8
4 0.79
5 0.8
6 0.82
7 0.85
8 0.84
9 0.82
10 0.81
11 0.83
12 0.83
13 0.81
14 0.79
15 0.77
16 0.74
17 0.7
18 0.67
19 0.61
20 0.57
21 0.52
22 0.54
23 0.5
24 0.52
25 0.56
26 0.58
27 0.62
28 0.62
29 0.67
30 0.6
31 0.64
32 0.61
33 0.6
34 0.59
35 0.52
36 0.49
37 0.49
38 0.48
39 0.45
40 0.41
41 0.33
42 0.31
43 0.37
44 0.44
45 0.45