Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423XBM8

Protein Details
Accession A0A423XBM8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
54-74QGTHPRSPPNHVAKRLRRSSLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008949  Isoprenoid_synthase_dom_sf  
IPR000092  Polyprenyl_synt  
IPR033749  Polyprenyl_synt_CS  
Gene Ontology GO:0016740  F:transferase activity  
GO:0046165  P:alcohol biosynthetic process  
GO:0008299  P:isoprenoid biosynthetic process  
GO:0042181  P:ketone biosynthetic process  
GO:0043386  P:mycotoxin biosynthetic process  
GO:1901362  P:organic cyclic compound biosynthetic process  
Pfam View protein in Pfam  
PF00348  polyprenyl_synt  
PROSITE View protein in PROSITE  
PS00723  POLYPRENYL_SYNTHASE_1  
PS00444  POLYPRENYL_SYNTHASE_2  
CDD cd00685  Trans_IPPS_HT  
Amino Acid Sequences MPPPSASNSTSKYLSSPNAIPPRTSSTGHKHTITSPSSRASVLNPVTEGDWISQGTHPRSPPNHVAKRLRRSSLPSTSLFASMSQPPERPDPSRFAYEDFNFIGGRNTWAADKDKVITGPFEYLNGQRGKDFRSQLIGAFNAWLEVPPESIEVITKVVGMLHTASLLIDDVEDNSLLRRGLPVAHSIFGVPQTINSANYVYFRALGELQKLNNPRCISVFAEELLNLHRGQGMDLFWRDTLTCPTEDEYLEMVGNKTGGLFRLGIKLMQAESRAARPVDCVPLVNLIGLSFQIRDDYQNLHSTEYSENKGLAEDLTEGKFSFPVIHSIRYDPANLQLINILKQRTSDDEVKRYAIKYMEGTGSFEYTRRVLAVLLERARKVAAEIDGGELKNRGIQAILDKMVIGGAGEMHFPVKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.34
4 0.39
5 0.47
6 0.47
7 0.45
8 0.44
9 0.49
10 0.47
11 0.46
12 0.44
13 0.44
14 0.52
15 0.56
16 0.54
17 0.48
18 0.48
19 0.54
20 0.51
21 0.47
22 0.42
23 0.4
24 0.4
25 0.38
26 0.35
27 0.28
28 0.33
29 0.3
30 0.29
31 0.26
32 0.25
33 0.24
34 0.24
35 0.22
36 0.14
37 0.14
38 0.12
39 0.13
40 0.15
41 0.21
42 0.24
43 0.29
44 0.3
45 0.36
46 0.39
47 0.45
48 0.52
49 0.56
50 0.61
51 0.65
52 0.74
53 0.75
54 0.82
55 0.83
56 0.77
57 0.71
58 0.7
59 0.69
60 0.68
61 0.63
62 0.54
63 0.5
64 0.47
65 0.43
66 0.36
67 0.28
68 0.22
69 0.21
70 0.24
71 0.24
72 0.24
73 0.25
74 0.31
75 0.34
76 0.34
77 0.34
78 0.35
79 0.37
80 0.41
81 0.39
82 0.36
83 0.39
84 0.36
85 0.36
86 0.3
87 0.27
88 0.22
89 0.21
90 0.21
91 0.15
92 0.16
93 0.13
94 0.13
95 0.12
96 0.15
97 0.18
98 0.18
99 0.19
100 0.18
101 0.2
102 0.2
103 0.2
104 0.18
105 0.16
106 0.17
107 0.15
108 0.15
109 0.15
110 0.15
111 0.21
112 0.21
113 0.21
114 0.2
115 0.22
116 0.25
117 0.29
118 0.31
119 0.25
120 0.29
121 0.29
122 0.28
123 0.29
124 0.26
125 0.19
126 0.17
127 0.15
128 0.11
129 0.1
130 0.08
131 0.06
132 0.06
133 0.06
134 0.06
135 0.07
136 0.06
137 0.06
138 0.07
139 0.06
140 0.07
141 0.06
142 0.06
143 0.05
144 0.06
145 0.05
146 0.06
147 0.06
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.04
155 0.03
156 0.03
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.06
163 0.06
164 0.06
165 0.06
166 0.06
167 0.08
168 0.09
169 0.12
170 0.13
171 0.13
172 0.13
173 0.13
174 0.13
175 0.12
176 0.12
177 0.07
178 0.06
179 0.08
180 0.09
181 0.09
182 0.1
183 0.1
184 0.09
185 0.1
186 0.11
187 0.08
188 0.08
189 0.08
190 0.09
191 0.09
192 0.1
193 0.12
194 0.13
195 0.13
196 0.17
197 0.21
198 0.21
199 0.25
200 0.25
201 0.22
202 0.22
203 0.24
204 0.21
205 0.18
206 0.18
207 0.13
208 0.13
209 0.12
210 0.11
211 0.1
212 0.1
213 0.08
214 0.07
215 0.08
216 0.08
217 0.08
218 0.1
219 0.09
220 0.1
221 0.11
222 0.12
223 0.11
224 0.11
225 0.11
226 0.11
227 0.13
228 0.12
229 0.12
230 0.12
231 0.14
232 0.15
233 0.15
234 0.15
235 0.12
236 0.11
237 0.11
238 0.1
239 0.09
240 0.08
241 0.07
242 0.06
243 0.05
244 0.05
245 0.06
246 0.07
247 0.07
248 0.08
249 0.12
250 0.12
251 0.12
252 0.12
253 0.12
254 0.12
255 0.12
256 0.12
257 0.11
258 0.12
259 0.13
260 0.16
261 0.15
262 0.14
263 0.15
264 0.17
265 0.19
266 0.18
267 0.17
268 0.15
269 0.17
270 0.17
271 0.15
272 0.12
273 0.08
274 0.08
275 0.08
276 0.08
277 0.05
278 0.05
279 0.07
280 0.07
281 0.09
282 0.1
283 0.14
284 0.16
285 0.21
286 0.22
287 0.23
288 0.22
289 0.23
290 0.25
291 0.26
292 0.26
293 0.21
294 0.21
295 0.19
296 0.19
297 0.17
298 0.13
299 0.1
300 0.09
301 0.11
302 0.11
303 0.12
304 0.11
305 0.11
306 0.12
307 0.11
308 0.12
309 0.1
310 0.18
311 0.2
312 0.23
313 0.25
314 0.27
315 0.3
316 0.28
317 0.29
318 0.22
319 0.25
320 0.26
321 0.24
322 0.22
323 0.23
324 0.23
325 0.26
326 0.29
327 0.24
328 0.19
329 0.21
330 0.23
331 0.24
332 0.29
333 0.34
334 0.37
335 0.42
336 0.45
337 0.47
338 0.48
339 0.43
340 0.41
341 0.34
342 0.29
343 0.25
344 0.26
345 0.28
346 0.25
347 0.27
348 0.24
349 0.25
350 0.23
351 0.21
352 0.2
353 0.16
354 0.16
355 0.14
356 0.13
357 0.12
358 0.16
359 0.22
360 0.27
361 0.33
362 0.36
363 0.36
364 0.36
365 0.36
366 0.31
367 0.25
368 0.23
369 0.19
370 0.18
371 0.18
372 0.21
373 0.25
374 0.25
375 0.25
376 0.21
377 0.19
378 0.19
379 0.18
380 0.14
381 0.11
382 0.13
383 0.17
384 0.23
385 0.24
386 0.21
387 0.21
388 0.2
389 0.2
390 0.18
391 0.12
392 0.06
393 0.06
394 0.06
395 0.07
396 0.07