Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423XMW7

Protein Details
Accession A0A423XMW7    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
40-74LLLLIWKGRKNRRERRKIEKIRRSIEKDRQRVRRDBasic
NLS Segment(s)
PositionSequence
46-73KGRKNRRERRKIEKIRRSIEKDRQRVRR
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, cyto 6.5, mito 4, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGNQFYDIDDTGSTLVPEKDAGDYKQPPSWCLRLLCIGPLLLLIWKGRKNRRERRKIEKIRRSIEKDRQRVRRDLDNWDRYRRTWRRRSEAWERGEELSQEQCRAGGFPYNTRYRYRETDIFPSGRTKAQVLDFRTPEGRADALKWYETLYDKSHDAGSSFLGDCKFWEEGYNEYMCTGEKRRDQAGQASLRRRLLEGVKPPVYWVRTISRRMSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.11
5 0.11
6 0.14
7 0.17
8 0.19
9 0.25
10 0.29
11 0.31
12 0.36
13 0.35
14 0.34
15 0.37
16 0.38
17 0.35
18 0.33
19 0.33
20 0.33
21 0.33
22 0.32
23 0.27
24 0.23
25 0.18
26 0.16
27 0.14
28 0.09
29 0.1
30 0.1
31 0.13
32 0.19
33 0.27
34 0.35
35 0.43
36 0.53
37 0.62
38 0.72
39 0.78
40 0.82
41 0.85
42 0.88
43 0.91
44 0.91
45 0.91
46 0.89
47 0.86
48 0.87
49 0.84
50 0.82
51 0.81
52 0.8
53 0.8
54 0.8
55 0.81
56 0.77
57 0.75
58 0.71
59 0.7
60 0.63
61 0.63
62 0.64
63 0.65
64 0.63
65 0.64
66 0.61
67 0.53
68 0.6
69 0.6
70 0.6
71 0.59
72 0.64
73 0.65
74 0.69
75 0.75
76 0.75
77 0.73
78 0.67
79 0.61
80 0.55
81 0.48
82 0.43
83 0.35
84 0.26
85 0.23
86 0.19
87 0.16
88 0.14
89 0.12
90 0.11
91 0.12
92 0.11
93 0.1
94 0.1
95 0.14
96 0.19
97 0.23
98 0.25
99 0.27
100 0.29
101 0.29
102 0.33
103 0.35
104 0.36
105 0.35
106 0.39
107 0.4
108 0.39
109 0.35
110 0.33
111 0.29
112 0.25
113 0.23
114 0.17
115 0.16
116 0.2
117 0.25
118 0.27
119 0.32
120 0.31
121 0.32
122 0.33
123 0.3
124 0.26
125 0.22
126 0.18
127 0.12
128 0.13
129 0.15
130 0.15
131 0.15
132 0.15
133 0.14
134 0.15
135 0.17
136 0.18
137 0.16
138 0.17
139 0.18
140 0.19
141 0.19
142 0.18
143 0.16
144 0.14
145 0.12
146 0.13
147 0.13
148 0.13
149 0.12
150 0.12
151 0.12
152 0.15
153 0.14
154 0.12
155 0.14
156 0.14
157 0.16
158 0.19
159 0.2
160 0.16
161 0.16
162 0.16
163 0.14
164 0.16
165 0.18
166 0.21
167 0.26
168 0.3
169 0.34
170 0.38
171 0.41
172 0.44
173 0.48
174 0.5
175 0.53
176 0.55
177 0.57
178 0.56
179 0.54
180 0.48
181 0.44
182 0.41
183 0.42
184 0.44
185 0.48
186 0.47
187 0.46
188 0.48
189 0.5
190 0.46
191 0.39
192 0.35
193 0.35
194 0.4
195 0.45