Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A443HP72

Protein Details
Accession A0A443HP72    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-81GITPKRAQMPRKGRPPQYRTVTAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, extr 6, plas 5, vacu 4, cyto 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSLLAAAGLATNQPPASLDPVAALGLQPITVGLPSPRLPSQALLLAGILGIILGILETGITPKRAQMPRKGRPPQYRTVTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.13
4 0.12
5 0.12
6 0.11
7 0.12
8 0.12
9 0.11
10 0.09
11 0.06
12 0.05
13 0.05
14 0.04
15 0.04
16 0.03
17 0.03
18 0.04
19 0.04
20 0.07
21 0.08
22 0.11
23 0.11
24 0.13
25 0.13
26 0.14
27 0.15
28 0.14
29 0.14
30 0.11
31 0.1
32 0.08
33 0.07
34 0.07
35 0.05
36 0.02
37 0.02
38 0.01
39 0.01
40 0.01
41 0.01
42 0.01
43 0.01
44 0.02
45 0.03
46 0.05
47 0.06
48 0.07
49 0.09
50 0.19
51 0.26
52 0.32
53 0.41
54 0.51
55 0.59
56 0.7
57 0.77
58 0.78
59 0.82
60 0.84
61 0.83