Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A443HUB1

Protein Details
Accession A0A443HUB1    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26KGDRTQQEQIRKRRHNLFRRLKEFNDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences KGDRTQQEQIRKRRHNLFRRLKEFNDRYEIEIWLTMRMPSGRIYIFATDPDVPIPSEDEVRAQKVPVVHKTSADYDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.85
4 0.86
5 0.86
6 0.85
7 0.83
8 0.76
9 0.76
10 0.7
11 0.63
12 0.59
13 0.49
14 0.44
15 0.4
16 0.36
17 0.26
18 0.24
19 0.2
20 0.14
21 0.13
22 0.1
23 0.09
24 0.09
25 0.09
26 0.09
27 0.1
28 0.09
29 0.1
30 0.12
31 0.12
32 0.12
33 0.12
34 0.13
35 0.12
36 0.12
37 0.11
38 0.11
39 0.1
40 0.1
41 0.11
42 0.1
43 0.11
44 0.11
45 0.14
46 0.16
47 0.19
48 0.19
49 0.18
50 0.19
51 0.22
52 0.28
53 0.32
54 0.36
55 0.34
56 0.36
57 0.4