Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A443I6B5

Protein Details
Accession A0A443I6B5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-69RLAAKGWKKIKSRNNNRNIHIHTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, extr 8, golg 4, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MGKYLYLTQQMSVWTAAVALRLIILLLTSPRCPMSSAAWQLDRETSRLAAKGWKKIKSRNNNRNIHIHTQYNYISK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.08
5 0.07
6 0.05
7 0.05
8 0.05
9 0.05
10 0.04
11 0.03
12 0.03
13 0.05
14 0.06
15 0.07
16 0.08
17 0.08
18 0.09
19 0.1
20 0.12
21 0.14
22 0.19
23 0.23
24 0.24
25 0.26
26 0.25
27 0.25
28 0.27
29 0.23
30 0.18
31 0.15
32 0.14
33 0.14
34 0.14
35 0.15
36 0.19
37 0.23
38 0.31
39 0.36
40 0.43
41 0.47
42 0.55
43 0.65
44 0.69
45 0.76
46 0.77
47 0.81
48 0.82
49 0.81
50 0.82
51 0.78
52 0.75
53 0.69
54 0.63
55 0.55
56 0.52