Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A443HSV8

Protein Details
Accession A0A443HSV8    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-27AKSKNSSQHNQSKKAHRNGIKKPKTFHydrophilic
NLS Segment(s)
PositionSequence
14-63KKAHRNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKERKEGKRE
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSKKAHRNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKERKEGKREVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.8
4 0.79
5 0.8
6 0.82
7 0.85
8 0.83
9 0.8
10 0.78
11 0.77
12 0.77
13 0.73
14 0.7
15 0.68
16 0.64
17 0.63
18 0.62
19 0.57
20 0.52
21 0.51
22 0.53
23 0.48
24 0.51
25 0.54
26 0.58
27 0.63
28 0.66
29 0.72
30 0.66
31 0.71
32 0.65
33 0.66
34 0.64
35 0.57
36 0.54
37 0.48
38 0.46
39 0.43
40 0.45
41 0.4
42 0.42
43 0.48
44 0.55
45 0.6