Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A443HTX4

Protein Details
Accession A0A443HTX4    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-28NRKIPWRLSRPQKARQRKRLRAVDRVVDHydrophilic
63-89KYTIFDKKEKKYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
7-20RLSRPQKARQRKRL
69-83KKEKKYRKGIHKLPK
Subcellular Location(s) mito 18.5, mito_nucl 12, nucl 4.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences NRKIPWRLSRPQKARQRKRLRAVDRVVDTVSAALQRNGGLTTKAVERWYAEMPREEEMVPKDKYTIFDKKEKKYRKGIHKLPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.91
4 0.9
5 0.92
6 0.93
7 0.89
8 0.87
9 0.82
10 0.79
11 0.71
12 0.63
13 0.53
14 0.42
15 0.35
16 0.25
17 0.19
18 0.13
19 0.11
20 0.09
21 0.09
22 0.09
23 0.09
24 0.1
25 0.09
26 0.07
27 0.07
28 0.08
29 0.09
30 0.1
31 0.1
32 0.1
33 0.1
34 0.13
35 0.15
36 0.16
37 0.15
38 0.17
39 0.18
40 0.18
41 0.19
42 0.16
43 0.16
44 0.17
45 0.21
46 0.19
47 0.18
48 0.18
49 0.18
50 0.21
51 0.25
52 0.31
53 0.3
54 0.38
55 0.46
56 0.54
57 0.63
58 0.69
59 0.7
60 0.73
61 0.78
62 0.8
63 0.83
64 0.84
65 0.85
66 0.85
67 0.89
68 0.87
69 0.88
70 0.82
71 0.8
72 0.8
73 0.79
74 0.8
75 0.77
76 0.79