Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A443I388

Protein Details
Accession A0A443I388    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-68DRCRARRPCCLLRRRCCPRPBasic
NLS Segment(s)
Subcellular Location(s) mito 16, extr 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MSLIRIALLLRSPGSLLSSDGKNKHGEHRECEAPPGDEPGAWPGKSSCDRCRARRPCCLLRRRCCPRPATSVGPAPPIGSASHAAPAAPDGPDISIPERRAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.12
4 0.14
5 0.17
6 0.22
7 0.24
8 0.26
9 0.29
10 0.3
11 0.37
12 0.43
13 0.43
14 0.43
15 0.47
16 0.5
17 0.47
18 0.48
19 0.4
20 0.32
21 0.28
22 0.27
23 0.21
24 0.15
25 0.15
26 0.17
27 0.18
28 0.16
29 0.16
30 0.13
31 0.17
32 0.23
33 0.27
34 0.27
35 0.34
36 0.39
37 0.45
38 0.55
39 0.6
40 0.6
41 0.64
42 0.68
43 0.68
44 0.72
45 0.76
46 0.75
47 0.74
48 0.8
49 0.8
50 0.8
51 0.76
52 0.72
53 0.68
54 0.66
55 0.64
56 0.59
57 0.54
58 0.53
59 0.48
60 0.45
61 0.39
62 0.31
63 0.25
64 0.2
65 0.16
66 0.12
67 0.12
68 0.1
69 0.13
70 0.12
71 0.12
72 0.11
73 0.12
74 0.11
75 0.1
76 0.1
77 0.08
78 0.09
79 0.11
80 0.13
81 0.15
82 0.2