Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A443HIW0

Protein Details
Accession A0A443HIW0    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
353-382QSRHTPPPRRELPFKRTRARDQRQSPPAEKHydrophilic
NLS Segment(s)
PositionSequence
241-254RRRKAGASRVSKRK
360-376PRRELPFKRTRARDQRQ
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR014751  XRCC4-like_C  
Amino Acid Sequences MSSSAEPPAPRILRLSRTDDPTAYVLIHVSRSGSEPLDLKLVATEGEAPYVGSVRQSRVKSLRAKNYQGSDDEWVQILSYVLRQSPPSDHDATWTTGLEVTASIRGEGDEDKELVILIRKRIDTITQRLGSISLKQDDEQAIELFEWTAITASAADTLETQVASLSARYRAAEDTISKLNAQLEELVRAKSEHEDQLIAKCVQLLNEKKLKIRNQQRLLASSNVDPGKAHELEAAVSDGSRRRKAGASRVSKRKVATPVDADSDEDGFEKMEVDTPKGRRPPAAAPDEEEEEEETDSDRPSTPQPLEDEEETASDDDMEDNEAIPPPAGKEAKVAEVNAVGGIQRNAGPPALQSRHTPPPRRELPFKRTRARDQRQSPPAEKPPPSRPSPEDDEETDDDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.49
4 0.54
5 0.57
6 0.51
7 0.48
8 0.42
9 0.37
10 0.29
11 0.23
12 0.18
13 0.16
14 0.16
15 0.13
16 0.12
17 0.12
18 0.15
19 0.17
20 0.16
21 0.17
22 0.18
23 0.19
24 0.21
25 0.2
26 0.17
27 0.15
28 0.14
29 0.12
30 0.11
31 0.13
32 0.1
33 0.11
34 0.11
35 0.1
36 0.1
37 0.11
38 0.1
39 0.11
40 0.13
41 0.17
42 0.25
43 0.26
44 0.34
45 0.39
46 0.46
47 0.52
48 0.59
49 0.65
50 0.67
51 0.72
52 0.71
53 0.71
54 0.67
55 0.59
56 0.52
57 0.46
58 0.39
59 0.34
60 0.27
61 0.22
62 0.18
63 0.16
64 0.13
65 0.09
66 0.09
67 0.1
68 0.1
69 0.12
70 0.13
71 0.15
72 0.18
73 0.21
74 0.25
75 0.27
76 0.26
77 0.28
78 0.3
79 0.3
80 0.28
81 0.24
82 0.19
83 0.16
84 0.16
85 0.13
86 0.1
87 0.09
88 0.1
89 0.1
90 0.09
91 0.08
92 0.08
93 0.1
94 0.1
95 0.11
96 0.1
97 0.11
98 0.11
99 0.1
100 0.1
101 0.1
102 0.14
103 0.14
104 0.16
105 0.19
106 0.2
107 0.21
108 0.22
109 0.28
110 0.29
111 0.33
112 0.39
113 0.36
114 0.36
115 0.35
116 0.36
117 0.3
118 0.27
119 0.25
120 0.19
121 0.19
122 0.19
123 0.21
124 0.21
125 0.21
126 0.18
127 0.14
128 0.12
129 0.11
130 0.11
131 0.08
132 0.07
133 0.06
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.05
141 0.05
142 0.05
143 0.05
144 0.06
145 0.06
146 0.06
147 0.06
148 0.04
149 0.05
150 0.05
151 0.05
152 0.06
153 0.07
154 0.08
155 0.08
156 0.1
157 0.1
158 0.11
159 0.12
160 0.12
161 0.14
162 0.15
163 0.15
164 0.14
165 0.15
166 0.15
167 0.13
168 0.12
169 0.12
170 0.1
171 0.13
172 0.14
173 0.13
174 0.12
175 0.12
176 0.13
177 0.12
178 0.14
179 0.12
180 0.12
181 0.13
182 0.13
183 0.15
184 0.18
185 0.16
186 0.13
187 0.13
188 0.12
189 0.12
190 0.19
191 0.2
192 0.22
193 0.27
194 0.28
195 0.3
196 0.37
197 0.41
198 0.44
199 0.51
200 0.56
201 0.57
202 0.62
203 0.61
204 0.58
205 0.54
206 0.47
207 0.38
208 0.29
209 0.28
210 0.22
211 0.2
212 0.17
213 0.15
214 0.18
215 0.17
216 0.17
217 0.12
218 0.12
219 0.12
220 0.13
221 0.12
222 0.07
223 0.06
224 0.07
225 0.11
226 0.15
227 0.17
228 0.16
229 0.18
230 0.23
231 0.28
232 0.36
233 0.42
234 0.48
235 0.55
236 0.65
237 0.67
238 0.65
239 0.62
240 0.58
241 0.56
242 0.51
243 0.46
244 0.4
245 0.39
246 0.39
247 0.38
248 0.32
249 0.25
250 0.21
251 0.16
252 0.12
253 0.1
254 0.07
255 0.07
256 0.07
257 0.06
258 0.1
259 0.11
260 0.14
261 0.2
262 0.22
263 0.29
264 0.33
265 0.34
266 0.32
267 0.35
268 0.4
269 0.43
270 0.46
271 0.4
272 0.39
273 0.41
274 0.41
275 0.37
276 0.3
277 0.22
278 0.17
279 0.16
280 0.13
281 0.11
282 0.09
283 0.09
284 0.1
285 0.1
286 0.1
287 0.13
288 0.19
289 0.19
290 0.21
291 0.24
292 0.27
293 0.3
294 0.3
295 0.29
296 0.23
297 0.23
298 0.2
299 0.18
300 0.13
301 0.09
302 0.08
303 0.07
304 0.07
305 0.08
306 0.07
307 0.07
308 0.08
309 0.09
310 0.09
311 0.09
312 0.09
313 0.08
314 0.15
315 0.15
316 0.15
317 0.18
318 0.2
319 0.25
320 0.27
321 0.26
322 0.21
323 0.21
324 0.21
325 0.17
326 0.15
327 0.09
328 0.09
329 0.09
330 0.09
331 0.1
332 0.12
333 0.13
334 0.13
335 0.13
336 0.13
337 0.22
338 0.24
339 0.25
340 0.27
341 0.33
342 0.43
343 0.52
344 0.6
345 0.55
346 0.62
347 0.7
348 0.73
349 0.77
350 0.76
351 0.77
352 0.79
353 0.83
354 0.82
355 0.82
356 0.85
357 0.86
358 0.87
359 0.87
360 0.85
361 0.87
362 0.86
363 0.87
364 0.8
365 0.78
366 0.78
367 0.76
368 0.74
369 0.71
370 0.72
371 0.71
372 0.72
373 0.7
374 0.64
375 0.63
376 0.64
377 0.63
378 0.58
379 0.53
380 0.54
381 0.49