Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A443I5Y5

Protein Details
Accession A0A443I5Y5    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
79-103MAEKMHHKRVERLKRREKRNKLLNSBasic
NLS Segment(s)
PositionSequence
23-99KKNGKNWHATKKPFRPGSGLTSYAKRVEERKQLAAARIQKIKERRAAKEEKARYEKMAEKMHHKRVERLKRREKRNK
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSAPATTPATTPAANATQVKGMKKNGKNWHATKKPFRPGSGLTSYAKRVEERKQLAAARIQKIKERRAAKEEKARYEKMAEKMHHKRVERLKRREKRNKLLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.19
4 0.22
5 0.26
6 0.28
7 0.29
8 0.34
9 0.41
10 0.46
11 0.54
12 0.58
13 0.62
14 0.68
15 0.7
16 0.73
17 0.72
18 0.75
19 0.75
20 0.74
21 0.77
22 0.72
23 0.66
24 0.6
25 0.55
26 0.53
27 0.47
28 0.41
29 0.33
30 0.31
31 0.31
32 0.29
33 0.26
34 0.21
35 0.2
36 0.24
37 0.31
38 0.32
39 0.32
40 0.34
41 0.35
42 0.35
43 0.38
44 0.37
45 0.33
46 0.34
47 0.33
48 0.35
49 0.39
50 0.42
51 0.44
52 0.44
53 0.44
54 0.48
55 0.55
56 0.57
57 0.61
58 0.63
59 0.64
60 0.65
61 0.62
62 0.56
63 0.54
64 0.53
65 0.51
66 0.53
67 0.46
68 0.49
69 0.57
70 0.64
71 0.66
72 0.62
73 0.63
74 0.66
75 0.75
76 0.75
77 0.77
78 0.79
79 0.81
80 0.9
81 0.93
82 0.93
83 0.92