Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A443HW09

Protein Details
Accession A0A443HW09    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-36SEPSSARRKSTRRVTPRAGKNTMKRDTKHydrophilic
285-318GGQRRDSPLPSKRIKRKRRTKAPGTKVAKKAKKKBasic
NLS Segment(s)
PositionSequence
16-22RKSTRRV
24-25PR
289-318RDSPLPSKRIKRKRRTKAPGTKVAKKAKKK
Subcellular Location(s) mito 18, mito_nucl 13.666, cyto_mito 10.166, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR018744  DUF2293  
Pfam View protein in Pfam  
PF10056  DUF2293  
Amino Acid Sequences MSLCVMAMSEPSSARRKSTRRVTPRAGKNTMKRDTKPVVDLEKPRTSDDLNKDTLVNLFGPDYLEELEDLDEEDDFEEEEEEVQTSSPSPPPQPSQPKRVKIPISTDPLEKTCIEKDPLPAGYIFVRRGDVYITRHCRSKTKDSKRTVYLVYDAKGKRTLGIRVPKDIYHSVRSDAVATASSRADAVKVRDERDLARSRKLLLAQFPKMPPSSLERILEHAFLKGSGRVGRSTKRSDERKAELAVEAHIRHLHTPYEELLDQGMQRDQARDRVWDAVQEVKAAWGGQRRDSPLPSKRIKRKRRTKAPGTKVAKKAKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.38
3 0.43
4 0.52
5 0.61
6 0.67
7 0.71
8 0.79
9 0.84
10 0.85
11 0.88
12 0.88
13 0.85
14 0.83
15 0.82
16 0.83
17 0.82
18 0.8
19 0.72
20 0.71
21 0.7
22 0.66
23 0.61
24 0.57
25 0.55
26 0.54
27 0.58
28 0.57
29 0.57
30 0.54
31 0.51
32 0.48
33 0.44
34 0.45
35 0.46
36 0.44
37 0.4
38 0.39
39 0.37
40 0.35
41 0.34
42 0.26
43 0.19
44 0.13
45 0.11
46 0.1
47 0.11
48 0.1
49 0.1
50 0.09
51 0.09
52 0.08
53 0.08
54 0.08
55 0.07
56 0.08
57 0.06
58 0.06
59 0.06
60 0.06
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.07
73 0.08
74 0.11
75 0.13
76 0.15
77 0.19
78 0.23
79 0.32
80 0.42
81 0.46
82 0.53
83 0.6
84 0.65
85 0.67
86 0.71
87 0.67
88 0.6
89 0.62
90 0.59
91 0.57
92 0.52
93 0.48
94 0.42
95 0.38
96 0.36
97 0.29
98 0.24
99 0.19
100 0.2
101 0.21
102 0.21
103 0.22
104 0.24
105 0.24
106 0.22
107 0.2
108 0.18
109 0.19
110 0.19
111 0.17
112 0.14
113 0.14
114 0.13
115 0.13
116 0.14
117 0.14
118 0.16
119 0.24
120 0.3
121 0.3
122 0.34
123 0.35
124 0.4
125 0.43
126 0.5
127 0.53
128 0.57
129 0.65
130 0.68
131 0.73
132 0.7
133 0.67
134 0.57
135 0.48
136 0.41
137 0.34
138 0.28
139 0.29
140 0.26
141 0.24
142 0.25
143 0.23
144 0.21
145 0.21
146 0.24
147 0.23
148 0.32
149 0.31
150 0.33
151 0.35
152 0.33
153 0.34
154 0.35
155 0.32
156 0.27
157 0.26
158 0.23
159 0.23
160 0.23
161 0.2
162 0.16
163 0.13
164 0.1
165 0.09
166 0.1
167 0.08
168 0.08
169 0.07
170 0.07
171 0.08
172 0.09
173 0.11
174 0.17
175 0.19
176 0.21
177 0.23
178 0.24
179 0.24
180 0.3
181 0.36
182 0.31
183 0.34
184 0.33
185 0.33
186 0.35
187 0.37
188 0.32
189 0.31
190 0.36
191 0.34
192 0.38
193 0.37
194 0.36
195 0.34
196 0.31
197 0.25
198 0.24
199 0.26
200 0.26
201 0.27
202 0.25
203 0.29
204 0.3
205 0.3
206 0.24
207 0.2
208 0.16
209 0.14
210 0.15
211 0.12
212 0.13
213 0.14
214 0.15
215 0.18
216 0.22
217 0.28
218 0.33
219 0.37
220 0.43
221 0.49
222 0.54
223 0.58
224 0.63
225 0.62
226 0.61
227 0.58
228 0.51
229 0.44
230 0.38
231 0.32
232 0.28
233 0.23
234 0.19
235 0.19
236 0.19
237 0.18
238 0.19
239 0.19
240 0.15
241 0.17
242 0.17
243 0.2
244 0.19
245 0.18
246 0.17
247 0.17
248 0.16
249 0.15
250 0.15
251 0.13
252 0.14
253 0.18
254 0.19
255 0.25
256 0.26
257 0.28
258 0.29
259 0.31
260 0.3
261 0.3
262 0.29
263 0.29
264 0.28
265 0.26
266 0.23
267 0.19
268 0.2
269 0.17
270 0.18
271 0.19
272 0.21
273 0.26
274 0.31
275 0.36
276 0.4
277 0.44
278 0.5
279 0.51
280 0.58
281 0.62
282 0.67
283 0.73
284 0.79
285 0.85
286 0.88
287 0.9
288 0.92
289 0.94
290 0.94
291 0.95
292 0.95
293 0.94
294 0.94
295 0.92
296 0.9
297 0.89
298 0.89