Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A443HK07

Protein Details
Accession A0A443HK07   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-72YSYRCSTPRCRPLHEQKKNFLFTTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 18, plas 4, mito 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MVKWILHVQSGPVVAVAVLCLQSVTLRLGTLGCYPICPFPKHGSCIGFYSYRCSTPRCRPLHEQKKNFLFTTQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.05
5 0.05
6 0.04
7 0.04
8 0.04
9 0.04
10 0.06
11 0.07
12 0.06
13 0.06
14 0.06
15 0.07
16 0.08
17 0.09
18 0.1
19 0.08
20 0.09
21 0.1
22 0.14
23 0.16
24 0.16
25 0.18
26 0.22
27 0.26
28 0.28
29 0.31
30 0.28
31 0.27
32 0.28
33 0.28
34 0.24
35 0.21
36 0.24
37 0.23
38 0.25
39 0.25
40 0.27
41 0.32
42 0.4
43 0.49
44 0.49
45 0.54
46 0.6
47 0.7
48 0.78
49 0.81
50 0.78
51 0.79
52 0.82
53 0.81
54 0.72