Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A443I0X7

Protein Details
Accession A0A443I0X7    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-40RVNVVYKGWKEKRRKGPPVDLEKCEHydrophilic
NLS Segment(s)
PositionSequence
27-30KRRK
Subcellular Location(s) cyto 14.5, cyto_nucl 12.5, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024645  Mitochondr_Som1  
Gene Ontology GO:0042720  C:mitochondrial inner membrane peptidase complex  
Pfam View protein in Pfam  
PF11093  Mitochondr_Som1  
Amino Acid Sequences MAPLVPVFPTEVLPERVNVVYKGWKEKRRKGPPVDLEKCELREMLQYSCNPPQEGVPSPGVVVCKPVLRLFRRCAGGLTVETTSWEKLQDAHKDGKIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.22
4 0.23
5 0.2
6 0.19
7 0.22
8 0.24
9 0.34
10 0.4
11 0.47
12 0.55
13 0.64
14 0.72
15 0.76
16 0.83
17 0.81
18 0.82
19 0.84
20 0.85
21 0.81
22 0.72
23 0.65
24 0.57
25 0.51
26 0.41
27 0.31
28 0.21
29 0.19
30 0.19
31 0.17
32 0.18
33 0.17
34 0.2
35 0.24
36 0.24
37 0.21
38 0.19
39 0.18
40 0.18
41 0.2
42 0.19
43 0.16
44 0.15
45 0.15
46 0.16
47 0.16
48 0.12
49 0.12
50 0.1
51 0.1
52 0.12
53 0.15
54 0.21
55 0.25
56 0.31
57 0.34
58 0.39
59 0.41
60 0.4
61 0.38
62 0.33
63 0.31
64 0.26
65 0.25
66 0.19
67 0.16
68 0.18
69 0.18
70 0.17
71 0.15
72 0.15
73 0.12
74 0.16
75 0.23
76 0.29
77 0.33
78 0.39