Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A443HPP0

Protein Details
Accession A0A443HPP0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MRKKSNPEEYKKYRREKGRMAQRAFRQRQIHydrophilic
NLS Segment(s)
PositionSequence
14-17RREK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, cyto 3, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MRKKSNPEEYKKYRREKGRMAQRAFRQRQIDTINKLEEEVSLLRDSIRKICQAATNELSSVNQKSLFLSSLPLQDSQQTAESELLKAIRYAGQIAGVDESVSMESGHESCSNQNLSSEQVSDSVDNQVPASDIPIGTEGWLLTDTSSSSANIPPQPEDLDYLADPIRNDIATTIPPQELHYPSSLDTGLTTYNFDPLLPSSNSLPIPKYLKPKTLPFHMLPYMDRDADTFAGRVFWKSLSLAFQYGTASLVPPPLQSNQHTVRRTPNAEDEKTAHASKMLSHSSAVIGKEAALRRIGARLEFLRTGTLDTDSPLWDANSSIQLRVLIEEDAQRRGEKMSDWLRIPDIVDYISSRCGMSSFAQLDALGTASVDGVGIDGIGRAAGQGGGLVTRLIEDIAWNASCFGDGPRYRAREVKEVIDSWVNTLTW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.87
4 0.88
5 0.88
6 0.88
7 0.85
8 0.85
9 0.84
10 0.86
11 0.81
12 0.78
13 0.72
14 0.63
15 0.64
16 0.63
17 0.61
18 0.56
19 0.57
20 0.52
21 0.47
22 0.46
23 0.39
24 0.31
25 0.27
26 0.22
27 0.18
28 0.15
29 0.15
30 0.16
31 0.19
32 0.21
33 0.23
34 0.26
35 0.26
36 0.27
37 0.31
38 0.36
39 0.37
40 0.42
41 0.39
42 0.37
43 0.34
44 0.33
45 0.3
46 0.28
47 0.25
48 0.2
49 0.17
50 0.16
51 0.17
52 0.19
53 0.19
54 0.15
55 0.16
56 0.17
57 0.21
58 0.22
59 0.22
60 0.2
61 0.22
62 0.22
63 0.21
64 0.22
65 0.18
66 0.17
67 0.19
68 0.2
69 0.17
70 0.18
71 0.17
72 0.13
73 0.13
74 0.13
75 0.13
76 0.13
77 0.14
78 0.13
79 0.14
80 0.14
81 0.14
82 0.14
83 0.11
84 0.1
85 0.09
86 0.09
87 0.06
88 0.06
89 0.06
90 0.05
91 0.06
92 0.07
93 0.09
94 0.09
95 0.1
96 0.11
97 0.16
98 0.17
99 0.16
100 0.17
101 0.16
102 0.17
103 0.18
104 0.18
105 0.13
106 0.13
107 0.14
108 0.14
109 0.14
110 0.15
111 0.15
112 0.14
113 0.14
114 0.12
115 0.12
116 0.11
117 0.11
118 0.08
119 0.07
120 0.07
121 0.09
122 0.08
123 0.08
124 0.09
125 0.07
126 0.06
127 0.07
128 0.06
129 0.05
130 0.06
131 0.06
132 0.06
133 0.07
134 0.07
135 0.08
136 0.1
137 0.13
138 0.15
139 0.16
140 0.16
141 0.17
142 0.18
143 0.17
144 0.18
145 0.15
146 0.14
147 0.13
148 0.14
149 0.13
150 0.13
151 0.12
152 0.1
153 0.11
154 0.09
155 0.09
156 0.07
157 0.08
158 0.08
159 0.1
160 0.11
161 0.11
162 0.11
163 0.13
164 0.17
165 0.17
166 0.17
167 0.17
168 0.16
169 0.16
170 0.17
171 0.16
172 0.11
173 0.1
174 0.09
175 0.09
176 0.08
177 0.09
178 0.07
179 0.09
180 0.09
181 0.08
182 0.08
183 0.08
184 0.12
185 0.11
186 0.12
187 0.11
188 0.14
189 0.16
190 0.16
191 0.16
192 0.14
193 0.18
194 0.21
195 0.29
196 0.29
197 0.34
198 0.36
199 0.42
200 0.43
201 0.45
202 0.46
203 0.38
204 0.4
205 0.36
206 0.34
207 0.28
208 0.29
209 0.25
210 0.2
211 0.19
212 0.14
213 0.13
214 0.13
215 0.13
216 0.09
217 0.07
218 0.09
219 0.09
220 0.09
221 0.09
222 0.08
223 0.08
224 0.09
225 0.1
226 0.1
227 0.11
228 0.12
229 0.11
230 0.11
231 0.11
232 0.1
233 0.1
234 0.07
235 0.07
236 0.06
237 0.07
238 0.07
239 0.07
240 0.09
241 0.11
242 0.14
243 0.15
244 0.22
245 0.27
246 0.35
247 0.36
248 0.37
249 0.42
250 0.45
251 0.46
252 0.42
253 0.45
254 0.44
255 0.43
256 0.44
257 0.39
258 0.37
259 0.38
260 0.35
261 0.26
262 0.2
263 0.19
264 0.19
265 0.22
266 0.19
267 0.16
268 0.16
269 0.16
270 0.17
271 0.19
272 0.18
273 0.12
274 0.11
275 0.11
276 0.16
277 0.16
278 0.16
279 0.14
280 0.14
281 0.14
282 0.18
283 0.18
284 0.13
285 0.16
286 0.16
287 0.19
288 0.2
289 0.19
290 0.18
291 0.17
292 0.18
293 0.15
294 0.15
295 0.11
296 0.11
297 0.12
298 0.12
299 0.12
300 0.11
301 0.1
302 0.09
303 0.09
304 0.1
305 0.15
306 0.16
307 0.15
308 0.16
309 0.16
310 0.16
311 0.17
312 0.16
313 0.1
314 0.1
315 0.16
316 0.17
317 0.19
318 0.2
319 0.19
320 0.19
321 0.2
322 0.2
323 0.16
324 0.22
325 0.27
326 0.31
327 0.33
328 0.34
329 0.34
330 0.33
331 0.33
332 0.26
333 0.19
334 0.14
335 0.13
336 0.13
337 0.13
338 0.14
339 0.14
340 0.12
341 0.11
342 0.11
343 0.13
344 0.13
345 0.19
346 0.18
347 0.18
348 0.19
349 0.19
350 0.19
351 0.16
352 0.15
353 0.08
354 0.06
355 0.05
356 0.05
357 0.05
358 0.04
359 0.04
360 0.03
361 0.03
362 0.03
363 0.03
364 0.03
365 0.03
366 0.03
367 0.03
368 0.03
369 0.04
370 0.04
371 0.04
372 0.04
373 0.04
374 0.05
375 0.05
376 0.05
377 0.05
378 0.05
379 0.06
380 0.06
381 0.05
382 0.06
383 0.07
384 0.11
385 0.12
386 0.11
387 0.12
388 0.12
389 0.12
390 0.12
391 0.12
392 0.19
393 0.2
394 0.26
395 0.34
396 0.38
397 0.4
398 0.45
399 0.48
400 0.48
401 0.5
402 0.51
403 0.49
404 0.46
405 0.48
406 0.48
407 0.43
408 0.36