Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A443I2Q2

Protein Details
Accession A0A443I2Q2   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
268-289ESGSKRSHSRSPAGRRKRSRSRBasic
NLS Segment(s)
PositionSequence
263-289PPRGGESGSKRSHSRSPAGRRKRSRSR
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012479  SAP30BP  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF07818  HCNGP  
Amino Acid Sequences MLGLGAYESSSEDEALVTAPQPKVKEAPKEQPPVQQLAVSQAPTAALAPEPAVEPPPTVAEPTGPVVGPFQPQSAPSPPPDRPRSRQSSPFSTTRALIQDLTLPPVPNLDIPPSPPGSPDPVANKKFAHFLDLKKQGIHFNEKLASSSSLKNPSLLTKLRQHVGIDEQGQYATSLPLDIWDPSALPAWGYKEELLKSQQEIRRALEEKKAAGQRESIEFVSGGTPSGSSRGGTPSSGRGKTSLAERVMSGLSRDHNDQTASRPPRGGESGSKRSHSRSPAGRRKRSRSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.13
6 0.15
7 0.18
8 0.19
9 0.22
10 0.28
11 0.34
12 0.43
13 0.45
14 0.53
15 0.59
16 0.67
17 0.67
18 0.68
19 0.65
20 0.6
21 0.54
22 0.45
23 0.36
24 0.34
25 0.34
26 0.26
27 0.22
28 0.17
29 0.16
30 0.15
31 0.15
32 0.09
33 0.06
34 0.06
35 0.07
36 0.07
37 0.08
38 0.08
39 0.1
40 0.1
41 0.1
42 0.1
43 0.13
44 0.13
45 0.13
46 0.13
47 0.12
48 0.13
49 0.15
50 0.15
51 0.12
52 0.12
53 0.12
54 0.13
55 0.15
56 0.14
57 0.13
58 0.12
59 0.13
60 0.18
61 0.2
62 0.21
63 0.23
64 0.28
65 0.32
66 0.4
67 0.48
68 0.51
69 0.53
70 0.6
71 0.65
72 0.65
73 0.7
74 0.67
75 0.67
76 0.64
77 0.62
78 0.56
79 0.49
80 0.43
81 0.37
82 0.32
83 0.25
84 0.21
85 0.17
86 0.19
87 0.18
88 0.2
89 0.19
90 0.17
91 0.15
92 0.16
93 0.16
94 0.11
95 0.12
96 0.12
97 0.11
98 0.12
99 0.15
100 0.16
101 0.16
102 0.15
103 0.16
104 0.17
105 0.18
106 0.19
107 0.24
108 0.31
109 0.32
110 0.33
111 0.33
112 0.29
113 0.32
114 0.29
115 0.27
116 0.21
117 0.23
118 0.3
119 0.36
120 0.35
121 0.32
122 0.33
123 0.32
124 0.32
125 0.35
126 0.27
127 0.23
128 0.24
129 0.24
130 0.23
131 0.21
132 0.2
133 0.16
134 0.18
135 0.19
136 0.22
137 0.22
138 0.22
139 0.21
140 0.21
141 0.24
142 0.23
143 0.24
144 0.25
145 0.28
146 0.28
147 0.29
148 0.27
149 0.24
150 0.25
151 0.24
152 0.19
153 0.17
154 0.16
155 0.14
156 0.14
157 0.13
158 0.1
159 0.07
160 0.05
161 0.04
162 0.04
163 0.05
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.07
170 0.08
171 0.08
172 0.07
173 0.08
174 0.09
175 0.1
176 0.11
177 0.12
178 0.14
179 0.15
180 0.18
181 0.19
182 0.19
183 0.2
184 0.27
185 0.28
186 0.3
187 0.32
188 0.32
189 0.36
190 0.37
191 0.38
192 0.36
193 0.36
194 0.32
195 0.37
196 0.39
197 0.34
198 0.32
199 0.32
200 0.28
201 0.29
202 0.31
203 0.24
204 0.2
205 0.18
206 0.18
207 0.16
208 0.13
209 0.1
210 0.07
211 0.07
212 0.07
213 0.09
214 0.09
215 0.08
216 0.1
217 0.13
218 0.14
219 0.15
220 0.17
221 0.23
222 0.3
223 0.32
224 0.31
225 0.29
226 0.29
227 0.3
228 0.34
229 0.33
230 0.27
231 0.26
232 0.25
233 0.26
234 0.26
235 0.24
236 0.19
237 0.15
238 0.17
239 0.19
240 0.22
241 0.22
242 0.23
243 0.25
244 0.25
245 0.28
246 0.35
247 0.37
248 0.37
249 0.37
250 0.35
251 0.39
252 0.41
253 0.4
254 0.4
255 0.44
256 0.51
257 0.54
258 0.58
259 0.55
260 0.56
261 0.59
262 0.56
263 0.56
264 0.56
265 0.63
266 0.69
267 0.78
268 0.83
269 0.86