Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A443HJR3

Protein Details
Accession A0A443HJR3   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
66-88FRWSFDKKQAKEKKKREEDQAAFHydrophilic
133-156VPELGKGARKRQKKQMKEAEKSAGHydrophilic
NLS Segment(s)
PositionSequence
74-81QAKEKKKR
137-149GKGARKRQKKQMK
Subcellular Location(s) cyto 12.5, cyto_nucl 8, mito 7, nucl 2.5, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MADTYTPPTASELLTDFFNQLLGGVENYFANFYKNFTSISAKRWIRMGVIVGAYLLVVRPLVDMFFRWSFDKKQAKEKKKREEDQAAFGADGKTAKMSPNSLRGPGKVLGEVETDDEDTVKGQGKDTGKATGVPELGKGARKRQKKQMKEAEKSAGATMEGMTEEELLELLDWSESDEEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.14
4 0.12
5 0.12
6 0.1
7 0.08
8 0.09
9 0.08
10 0.08
11 0.08
12 0.08
13 0.08
14 0.09
15 0.1
16 0.08
17 0.1
18 0.09
19 0.11
20 0.13
21 0.14
22 0.15
23 0.16
24 0.24
25 0.24
26 0.28
27 0.36
28 0.34
29 0.34
30 0.36
31 0.34
32 0.28
33 0.27
34 0.25
35 0.18
36 0.17
37 0.16
38 0.13
39 0.12
40 0.1
41 0.08
42 0.06
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.04
49 0.04
50 0.05
51 0.1
52 0.11
53 0.12
54 0.14
55 0.17
56 0.19
57 0.28
58 0.35
59 0.33
60 0.43
61 0.52
62 0.61
63 0.69
64 0.77
65 0.78
66 0.8
67 0.83
68 0.81
69 0.81
70 0.73
71 0.67
72 0.6
73 0.49
74 0.39
75 0.34
76 0.26
77 0.15
78 0.13
79 0.07
80 0.06
81 0.06
82 0.07
83 0.07
84 0.1
85 0.12
86 0.2
87 0.21
88 0.25
89 0.26
90 0.25
91 0.28
92 0.27
93 0.25
94 0.19
95 0.18
96 0.15
97 0.14
98 0.14
99 0.11
100 0.1
101 0.09
102 0.08
103 0.08
104 0.07
105 0.06
106 0.07
107 0.1
108 0.1
109 0.1
110 0.16
111 0.17
112 0.21
113 0.22
114 0.23
115 0.2
116 0.22
117 0.23
118 0.21
119 0.2
120 0.17
121 0.16
122 0.16
123 0.17
124 0.21
125 0.23
126 0.29
127 0.36
128 0.45
129 0.51
130 0.6
131 0.69
132 0.72
133 0.81
134 0.82
135 0.85
136 0.83
137 0.82
138 0.79
139 0.7
140 0.62
141 0.52
142 0.42
143 0.31
144 0.24
145 0.18
146 0.12
147 0.09
148 0.08
149 0.08
150 0.07
151 0.07
152 0.06
153 0.06
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.07