Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A443I1E7

Protein Details
Accession A0A443I1E7   
Localization Confidence High
Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
110-129GPACGPCKRAKIRCKHRLVLHydrophilic
241-266TVREENKPPVKRPRRARKPTQSVAFAHydrophilic
NLS Segment(s)
PositionSequence
48-53PPRKKR
178-182KRARK
206-220GPAKRQTRGSSKRKR
247-258KPPVKRPRRARK
Subcellular Location(s) cyto_nucl 14, nucl 13.5, cyto 13.5
Family & Domain DBs
Amino Acid Sequences MADEIEVVCRICGTPLEDGPYKDHYELCPTHFDRERFSGRLKLLRSDPPRKKRGSQAASGPVPNPQPVEAAGGDTNNGAPKPAEKPTAPAKGKKGVLSSAANDSEGQKLGPACGPCKRAKIRCKHRLVLDDASNVSPSKKRKRDAGSQVGVAADKQKDANNNDVSVVGVEAEAPPPAKRARKAQQKEGGAVSSETKPSLDAGPAAGPAKRQTRGSSKRKREAEEPQADSEAAAAAGATTATVREENKPPVKRPRRARKPTQSVAFADPVVPASTVQTVTPAAAPERRYPIPFPLDNLEGSAMIAYHRVQSRRFEALVEDANSKWVAAMEAFQAVKDHLDGWADQWARGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.26
4 0.28
5 0.3
6 0.32
7 0.35
8 0.35
9 0.32
10 0.32
11 0.28
12 0.33
13 0.34
14 0.34
15 0.38
16 0.37
17 0.44
18 0.48
19 0.48
20 0.45
21 0.5
22 0.53
23 0.47
24 0.49
25 0.48
26 0.46
27 0.51
28 0.48
29 0.46
30 0.46
31 0.52
32 0.57
33 0.61
34 0.67
35 0.7
36 0.76
37 0.76
38 0.77
39 0.78
40 0.8
41 0.75
42 0.71
43 0.7
44 0.7
45 0.68
46 0.63
47 0.53
48 0.46
49 0.42
50 0.37
51 0.29
52 0.2
53 0.18
54 0.16
55 0.19
56 0.15
57 0.16
58 0.15
59 0.14
60 0.13
61 0.12
62 0.13
63 0.11
64 0.11
65 0.09
66 0.09
67 0.11
68 0.15
69 0.19
70 0.23
71 0.21
72 0.26
73 0.34
74 0.44
75 0.45
76 0.47
77 0.48
78 0.51
79 0.54
80 0.52
81 0.46
82 0.37
83 0.38
84 0.35
85 0.32
86 0.29
87 0.27
88 0.24
89 0.22
90 0.21
91 0.19
92 0.16
93 0.14
94 0.11
95 0.1
96 0.11
97 0.14
98 0.14
99 0.15
100 0.2
101 0.25
102 0.26
103 0.35
104 0.42
105 0.48
106 0.55
107 0.63
108 0.69
109 0.75
110 0.8
111 0.77
112 0.75
113 0.72
114 0.69
115 0.64
116 0.55
117 0.47
118 0.4
119 0.35
120 0.3
121 0.24
122 0.2
123 0.18
124 0.23
125 0.31
126 0.37
127 0.4
128 0.47
129 0.54
130 0.62
131 0.68
132 0.7
133 0.62
134 0.56
135 0.53
136 0.45
137 0.38
138 0.28
139 0.22
140 0.12
141 0.1
142 0.1
143 0.11
144 0.16
145 0.18
146 0.25
147 0.23
148 0.23
149 0.23
150 0.22
151 0.2
152 0.15
153 0.13
154 0.06
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.05
161 0.05
162 0.07
163 0.11
164 0.14
165 0.17
166 0.25
167 0.34
168 0.45
169 0.5
170 0.57
171 0.61
172 0.59
173 0.59
174 0.52
175 0.43
176 0.32
177 0.28
178 0.21
179 0.15
180 0.13
181 0.11
182 0.1
183 0.09
184 0.1
185 0.1
186 0.08
187 0.07
188 0.07
189 0.08
190 0.09
191 0.09
192 0.09
193 0.09
194 0.12
195 0.17
196 0.18
197 0.19
198 0.23
199 0.33
200 0.43
201 0.53
202 0.6
203 0.65
204 0.72
205 0.76
206 0.76
207 0.72
208 0.72
209 0.71
210 0.69
211 0.63
212 0.55
213 0.5
214 0.46
215 0.39
216 0.29
217 0.19
218 0.1
219 0.06
220 0.04
221 0.03
222 0.03
223 0.03
224 0.02
225 0.02
226 0.03
227 0.04
228 0.05
229 0.07
230 0.12
231 0.17
232 0.25
233 0.34
234 0.39
235 0.45
236 0.55
237 0.64
238 0.68
239 0.75
240 0.78
241 0.81
242 0.86
243 0.9
244 0.9
245 0.9
246 0.9
247 0.86
248 0.79
249 0.71
250 0.66
251 0.56
252 0.45
253 0.35
254 0.27
255 0.21
256 0.17
257 0.13
258 0.09
259 0.09
260 0.11
261 0.11
262 0.1
263 0.11
264 0.1
265 0.11
266 0.12
267 0.11
268 0.12
269 0.15
270 0.18
271 0.22
272 0.28
273 0.3
274 0.32
275 0.33
276 0.38
277 0.42
278 0.4
279 0.39
280 0.37
281 0.36
282 0.33
283 0.32
284 0.26
285 0.18
286 0.17
287 0.14
288 0.09
289 0.07
290 0.08
291 0.08
292 0.12
293 0.17
294 0.2
295 0.23
296 0.3
297 0.35
298 0.4
299 0.39
300 0.35
301 0.32
302 0.35
303 0.38
304 0.34
305 0.31
306 0.25
307 0.27
308 0.26
309 0.23
310 0.18
311 0.12
312 0.11
313 0.09
314 0.11
315 0.1
316 0.14
317 0.15
318 0.14
319 0.15
320 0.14
321 0.15
322 0.14
323 0.13
324 0.1
325 0.12
326 0.12
327 0.12
328 0.2
329 0.2