Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A443HRD7

Protein Details
Accession A0A443HRD7    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-40LPCLRMQIACRRNRRRRDSTCQEMTGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000791  Gpr1/Fun34/SatP  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01184  Gpr1_Fun34_YaaH  
Amino Acid Sequences MIHIYSYVSVLPKTLPCLRMQIACRRNRRRRDSTCQEMTGRNQPGSQERNCNYTVSRVLAPPYIKLENSGPLGLFGFAVTTFVLGLYSFGVKALIKEYSDSLFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.24
4 0.29
5 0.31
6 0.35
7 0.38
8 0.43
9 0.46
10 0.53
11 0.62
12 0.67
13 0.75
14 0.79
15 0.84
16 0.84
17 0.84
18 0.87
19 0.86
20 0.84
21 0.8
22 0.74
23 0.66
24 0.59
25 0.54
26 0.51
27 0.44
28 0.35
29 0.3
30 0.28
31 0.31
32 0.33
33 0.31
34 0.31
35 0.3
36 0.33
37 0.33
38 0.32
39 0.26
40 0.24
41 0.24
42 0.18
43 0.18
44 0.15
45 0.15
46 0.18
47 0.18
48 0.16
49 0.18
50 0.17
51 0.16
52 0.18
53 0.18
54 0.18
55 0.19
56 0.18
57 0.14
58 0.13
59 0.14
60 0.12
61 0.11
62 0.07
63 0.06
64 0.05
65 0.06
66 0.05
67 0.05
68 0.04
69 0.04
70 0.05
71 0.04
72 0.05
73 0.05
74 0.06
75 0.06
76 0.06
77 0.07
78 0.07
79 0.08
80 0.11
81 0.12
82 0.12
83 0.14
84 0.16