Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A443I7T4

Protein Details
Accession A0A443I7T4    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
36-66VGEHWRDVKAHRKRQKRQKLENPPRRRCWDWBasic
NLS Segment(s)
PositionSequence
44-61KAHRKRQKRQKLENPPRR
Subcellular Location(s) plas 16, mito 6, E.R. 2, nucl 1, cyto 1, extr 1, cyto_nucl 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLLGGSVLTVVSVPFRILEYLSIELSTSNSCAMGKVGEHWRDVKAHRKRQKRQKLENPPRRRCWDWMLVMGSCHYARNRSSFKEYRRVGRKVTTAVIPGDVYVAGVGTVELMEGRQHIGLYCIMFCIFQMLSVMAFALQNIIAVLAGRRVSRKMVCSQMTPKVILSGMVRSSMGWTGWPWMETHREKRFSLMDPSSLVSIFVQKTSRRFCPKFSTAGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.09
5 0.11
6 0.13
7 0.15
8 0.15
9 0.14
10 0.14
11 0.13
12 0.14
13 0.13
14 0.1
15 0.08
16 0.09
17 0.09
18 0.09
19 0.09
20 0.09
21 0.09
22 0.14
23 0.22
24 0.24
25 0.26
26 0.27
27 0.29
28 0.32
29 0.36
30 0.4
31 0.43
32 0.51
33 0.58
34 0.67
35 0.75
36 0.82
37 0.89
38 0.9
39 0.91
40 0.91
41 0.94
42 0.94
43 0.95
44 0.95
45 0.93
46 0.9
47 0.86
48 0.79
49 0.72
50 0.68
51 0.65
52 0.57
53 0.53
54 0.47
55 0.4
56 0.37
57 0.32
58 0.27
59 0.19
60 0.18
61 0.13
62 0.14
63 0.15
64 0.22
65 0.25
66 0.27
67 0.36
68 0.4
69 0.45
70 0.51
71 0.53
72 0.55
73 0.59
74 0.58
75 0.53
76 0.52
77 0.5
78 0.43
79 0.42
80 0.34
81 0.27
82 0.24
83 0.22
84 0.16
85 0.13
86 0.1
87 0.08
88 0.06
89 0.04
90 0.04
91 0.03
92 0.03
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.03
101 0.03
102 0.04
103 0.04
104 0.04
105 0.06
106 0.06
107 0.07
108 0.07
109 0.06
110 0.06
111 0.06
112 0.06
113 0.07
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.06
120 0.06
121 0.04
122 0.04
123 0.04
124 0.04
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.04
132 0.05
133 0.07
134 0.07
135 0.09
136 0.1
137 0.15
138 0.18
139 0.21
140 0.25
141 0.32
142 0.33
143 0.37
144 0.41
145 0.45
146 0.44
147 0.41
148 0.36
149 0.29
150 0.27
151 0.24
152 0.2
153 0.16
154 0.15
155 0.15
156 0.15
157 0.13
158 0.15
159 0.14
160 0.13
161 0.1
162 0.1
163 0.12
164 0.13
165 0.14
166 0.13
167 0.15
168 0.23
169 0.29
170 0.39
171 0.44
172 0.48
173 0.48
174 0.53
175 0.54
176 0.5
177 0.52
178 0.45
179 0.38
180 0.35
181 0.36
182 0.32
183 0.27
184 0.24
185 0.16
186 0.18
187 0.16
188 0.18
189 0.21
190 0.24
191 0.32
192 0.38
193 0.47
194 0.52
195 0.54
196 0.58
197 0.63
198 0.64