Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A443HQT4

Protein Details
Accession A0A443HQT4    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
173-205NANKKQAKPKSVTKPKSDKSKVTKKGKDEKIAIHydrophilic
NLS Segment(s)
PositionSequence
115-208PKKTQAQKKATAKPKSKGNASQKSKASNKSTKAESKSKTEKASSAASKGKAATNSKASNANKKQAKPKSVTKPKSDKSKVTKKGKDEKIAISPR
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MSSTTKMDMRMDVNFLIQDPNDTGSPIPTSIDFTKEDFNAAVQLHNYWNDAWAQDLAIRETNPDTNTDDTMSEVVESHSEVTAMDDDIPSLSYSVGSHVESPSPAEKVDGEKSTPKKTQAQKKATAKPKSKGNASQKSKASNKSTKAESKSKTEKASSAASKGKAATNSKASNANKKQAKPKSVTKPKSDKSKVTKKGKDEKIAISPRIKLILKPESESERST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.19
4 0.16
5 0.15
6 0.14
7 0.16
8 0.14
9 0.15
10 0.14
11 0.14
12 0.15
13 0.14
14 0.13
15 0.11
16 0.16
17 0.17
18 0.2
19 0.19
20 0.2
21 0.24
22 0.23
23 0.23
24 0.18
25 0.17
26 0.18
27 0.16
28 0.16
29 0.12
30 0.14
31 0.14
32 0.15
33 0.16
34 0.12
35 0.13
36 0.12
37 0.12
38 0.12
39 0.1
40 0.09
41 0.1
42 0.11
43 0.12
44 0.13
45 0.13
46 0.13
47 0.14
48 0.17
49 0.15
50 0.17
51 0.18
52 0.17
53 0.19
54 0.18
55 0.16
56 0.14
57 0.14
58 0.12
59 0.09
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.05
68 0.06
69 0.07
70 0.07
71 0.07
72 0.06
73 0.06
74 0.06
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.06
82 0.08
83 0.07
84 0.08
85 0.08
86 0.09
87 0.09
88 0.1
89 0.1
90 0.09
91 0.09
92 0.08
93 0.09
94 0.11
95 0.15
96 0.14
97 0.14
98 0.2
99 0.23
100 0.28
101 0.3
102 0.3
103 0.34
104 0.41
105 0.5
106 0.55
107 0.59
108 0.63
109 0.69
110 0.75
111 0.77
112 0.78
113 0.74
114 0.69
115 0.7
116 0.66
117 0.62
118 0.62
119 0.63
120 0.64
121 0.64
122 0.66
123 0.61
124 0.64
125 0.64
126 0.62
127 0.6
128 0.57
129 0.56
130 0.54
131 0.57
132 0.56
133 0.57
134 0.58
135 0.53
136 0.55
137 0.58
138 0.58
139 0.56
140 0.51
141 0.47
142 0.42
143 0.46
144 0.4
145 0.37
146 0.36
147 0.33
148 0.33
149 0.33
150 0.32
151 0.31
152 0.32
153 0.31
154 0.34
155 0.35
156 0.35
157 0.43
158 0.42
159 0.47
160 0.49
161 0.54
162 0.53
163 0.57
164 0.65
165 0.65
166 0.7
167 0.66
168 0.7
169 0.72
170 0.76
171 0.78
172 0.78
173 0.8
174 0.8
175 0.84
176 0.82
177 0.8
178 0.79
179 0.82
180 0.83
181 0.83
182 0.83
183 0.82
184 0.86
185 0.85
186 0.84
187 0.78
188 0.74
189 0.73
190 0.74
191 0.7
192 0.63
193 0.57
194 0.51
195 0.52
196 0.47
197 0.39
198 0.4
199 0.43
200 0.41
201 0.41
202 0.44
203 0.45