Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1DYT1

Protein Details
Accession A0A0D1DYT1   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-50GAPGRGGKDNKKDQQKKWEPPLPTRVGKKKKRGPDSSSKLPTVHydrophilic
NLS Segment(s)
PositionSequence
10-41PGRGGKDNKKDQQKKWEPPLPTRVGKKKKRGP
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005937  26S_Psome_P45-like  
IPR003593  AAA+_ATPase  
IPR041569  AAA_lid_3  
IPR003959  ATPase_AAA_core  
IPR003960  ATPase_AAA_CS  
IPR012340  NA-bd_OB-fold  
IPR027417  P-loop_NTPase  
IPR032501  Prot_ATP_ID_OB_C  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0008540  C:proteasome regulatory particle, base subcomplex  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0036402  F:proteasome-activating activity  
GO:0043161  P:proteasome-mediated ubiquitin-dependent protein catabolic process  
KEGG uma:UMAG_02562  -  
Pfam View protein in Pfam  
PF00004  AAA  
PF17862  AAA_lid_3  
PF16450  Prot_ATP_ID_OB  
PROSITE View protein in PROSITE  
PS00674  AAA  
CDD cd19502  RecA-like_PAN_like  
Amino Acid Sequences MGQAPSGGAPGRGGKDNKKDQQKKWEPPLPTRVGKKKKRGPDSSSKLPTVYPNTRCRLKLLKLERIKDHLLLEEEFVQNQERLKPQEDKDAEERTRVDDLRGSPMAVGTLEEIIDDEHAIVSSATGPEYYVSIMSFVDKDLLEPGCSVLLHHKAMAIVGVLSDDADPMVSVMKLDKAPSESYADIGGLETQIQEIKEAVELPLTHPELYEEMGIRPPKGVILYGVPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVADEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTLLELLNQLDGFDTRHDVKVIMATNRIESLDPALIRPGRIDRKIEFPLPDQKTKMHIFKLHTSRMNLDSDVDLEEFVAMKDDLSGADIKSLVTEAGLLALRERRMRVTKKDFTTARERVIDRKNEGTPEGLYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.47
3 0.57
4 0.64
5 0.71
6 0.77
7 0.78
8 0.84
9 0.87
10 0.87
11 0.87
12 0.85
13 0.8
14 0.79
15 0.82
16 0.78
17 0.75
18 0.75
19 0.75
20 0.78
21 0.82
22 0.84
23 0.84
24 0.86
25 0.88
26 0.88
27 0.86
28 0.87
29 0.86
30 0.86
31 0.83
32 0.74
33 0.65
34 0.57
35 0.55
36 0.53
37 0.53
38 0.5
39 0.52
40 0.57
41 0.62
42 0.61
43 0.61
44 0.6
45 0.58
46 0.6
47 0.61
48 0.64
49 0.66
50 0.72
51 0.71
52 0.68
53 0.64
54 0.57
55 0.49
56 0.42
57 0.37
58 0.31
59 0.28
60 0.26
61 0.24
62 0.21
63 0.2
64 0.18
65 0.17
66 0.18
67 0.2
68 0.21
69 0.25
70 0.3
71 0.37
72 0.37
73 0.46
74 0.46
75 0.47
76 0.48
77 0.53
78 0.48
79 0.45
80 0.43
81 0.36
82 0.4
83 0.34
84 0.3
85 0.26
86 0.27
87 0.3
88 0.3
89 0.26
90 0.21
91 0.21
92 0.2
93 0.15
94 0.13
95 0.07
96 0.07
97 0.06
98 0.06
99 0.06
100 0.05
101 0.05
102 0.05
103 0.05
104 0.04
105 0.04
106 0.05
107 0.04
108 0.04
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.07
117 0.06
118 0.05
119 0.06
120 0.06
121 0.07
122 0.07
123 0.06
124 0.08
125 0.08
126 0.08
127 0.1
128 0.11
129 0.1
130 0.1
131 0.11
132 0.09
133 0.09
134 0.09
135 0.11
136 0.15
137 0.15
138 0.15
139 0.15
140 0.14
141 0.14
142 0.14
143 0.09
144 0.05
145 0.05
146 0.05
147 0.04
148 0.04
149 0.04
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.04
156 0.03
157 0.04
158 0.04
159 0.07
160 0.07
161 0.08
162 0.09
163 0.11
164 0.12
165 0.13
166 0.16
167 0.14
168 0.14
169 0.14
170 0.13
171 0.1
172 0.1
173 0.08
174 0.05
175 0.05
176 0.04
177 0.04
178 0.05
179 0.05
180 0.05
181 0.05
182 0.06
183 0.06
184 0.06
185 0.06
186 0.06
187 0.07
188 0.07
189 0.12
190 0.13
191 0.12
192 0.12
193 0.12
194 0.12
195 0.12
196 0.12
197 0.07
198 0.07
199 0.11
200 0.12
201 0.11
202 0.11
203 0.1
204 0.1
205 0.1
206 0.09
207 0.06
208 0.07
209 0.08
210 0.08
211 0.08
212 0.08
213 0.07
214 0.08
215 0.07
216 0.06
217 0.05
218 0.06
219 0.06
220 0.07
221 0.08
222 0.08
223 0.14
224 0.14
225 0.15
226 0.14
227 0.14
228 0.16
229 0.16
230 0.15
231 0.09
232 0.09
233 0.09
234 0.09
235 0.1
236 0.07
237 0.08
238 0.11
239 0.11
240 0.11
241 0.11
242 0.1
243 0.11
244 0.14
245 0.15
246 0.12
247 0.13
248 0.13
249 0.16
250 0.18
251 0.17
252 0.14
253 0.14
254 0.16
255 0.16
256 0.17
257 0.14
258 0.15
259 0.19
260 0.19
261 0.17
262 0.15
263 0.14
264 0.12
265 0.12
266 0.1
267 0.05
268 0.05
269 0.05
270 0.05
271 0.05
272 0.05
273 0.05
274 0.05
275 0.06
276 0.06
277 0.06
278 0.08
279 0.09
280 0.12
281 0.13
282 0.17
283 0.22
284 0.24
285 0.25
286 0.27
287 0.29
288 0.28
289 0.28
290 0.24
291 0.18
292 0.17
293 0.18
294 0.15
295 0.14
296 0.13
297 0.13
298 0.15
299 0.15
300 0.13
301 0.12
302 0.11
303 0.11
304 0.1
305 0.12
306 0.12
307 0.13
308 0.14
309 0.14
310 0.14
311 0.18
312 0.21
313 0.19
314 0.21
315 0.2
316 0.21
317 0.21
318 0.22
319 0.17
320 0.14
321 0.15
322 0.15
323 0.15
324 0.14
325 0.18
326 0.18
327 0.18
328 0.2
329 0.25
330 0.29
331 0.33
332 0.37
333 0.34
334 0.41
335 0.46
336 0.48
337 0.42
338 0.39
339 0.46
340 0.47
341 0.5
342 0.45
343 0.42
344 0.44
345 0.48
346 0.49
347 0.45
348 0.45
349 0.46
350 0.54
351 0.6
352 0.61
353 0.6
354 0.57
355 0.55
356 0.53
357 0.5
358 0.41
359 0.34
360 0.27
361 0.22
362 0.21
363 0.17
364 0.13
365 0.11
366 0.1
367 0.09
368 0.08
369 0.09
370 0.07
371 0.07
372 0.07
373 0.08
374 0.07
375 0.09
376 0.11
377 0.08
378 0.1
379 0.1
380 0.1
381 0.1
382 0.1
383 0.08
384 0.07
385 0.07
386 0.05
387 0.08
388 0.09
389 0.09
390 0.11
391 0.15
392 0.18
393 0.22
394 0.24
395 0.29
396 0.37
397 0.45
398 0.53
399 0.6
400 0.66
401 0.68
402 0.76
403 0.72
404 0.69
405 0.71
406 0.66
407 0.62
408 0.61
409 0.57
410 0.56
411 0.62
412 0.64
413 0.59
414 0.61
415 0.58
416 0.55
417 0.54
418 0.48