Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A443HVN9

Protein Details
Accession A0A443HVN9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-47KLKGLKVKGGRVEKKKKKKEKKEHAETSREABasic
NLS Segment(s)
PositionSequence
14-39GKLKLKGLKVKGGRVEKKKKKKEKKE
89-100RRKRLNDRLKRE
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MAPGDEYSAVSGAGKLKLKGLKVKGGRVEKKKKKKEKKEHAETSREASAVAESQQDSGEASAAATAEQEGGDVPIIEKTEAEKKYEEMRRKRLNDRLKREGVKTHKERVEELNKYLSTLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.22
4 0.26
5 0.3
6 0.36
7 0.38
8 0.42
9 0.44
10 0.5
11 0.53
12 0.6
13 0.66
14 0.68
15 0.75
16 0.77
17 0.83
18 0.87
19 0.9
20 0.91
21 0.93
22 0.94
23 0.95
24 0.95
25 0.95
26 0.95
27 0.91
28 0.87
29 0.77
30 0.7
31 0.6
32 0.49
33 0.38
34 0.27
35 0.2
36 0.14
37 0.13
38 0.09
39 0.08
40 0.08
41 0.08
42 0.08
43 0.07
44 0.07
45 0.06
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.04
62 0.05
63 0.05
64 0.05
65 0.07
66 0.15
67 0.16
68 0.17
69 0.17
70 0.19
71 0.28
72 0.35
73 0.42
74 0.43
75 0.53
76 0.6
77 0.66
78 0.72
79 0.73
80 0.76
81 0.78
82 0.78
83 0.77
84 0.76
85 0.75
86 0.7
87 0.69
88 0.67
89 0.67
90 0.64
91 0.64
92 0.6
93 0.57
94 0.57
95 0.57
96 0.59
97 0.52
98 0.49
99 0.48
100 0.44
101 0.43
102 0.4
103 0.31
104 0.25
105 0.23
106 0.24
107 0.21
108 0.22
109 0.24
110 0.28
111 0.28