Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A443I515

Protein Details
Accession A0A443I515    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
99-129EAAKKGKEKEREEKEEKKKNRRSVTNDGLANBasic
NLS Segment(s)
PositionSequence
101-120AKKGKEKEREEKEEKKKNRR
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MSGETPIVSHGRGGHGNIGKDDTPYADASIVREGPVGDQGDGAYSAGRGGAGNIGSPHIPPSKKAVHDNEMIPELAIRNSTDENYHTGRGGQGNVHLDEAAKKGKEKEREEKEEKKKNRRSVTNDGLANWLKEKLLRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.29
4 0.29
5 0.31
6 0.27
7 0.26
8 0.25
9 0.18
10 0.16
11 0.16
12 0.15
13 0.13
14 0.13
15 0.14
16 0.17
17 0.15
18 0.13
19 0.13
20 0.12
21 0.11
22 0.15
23 0.14
24 0.11
25 0.11
26 0.1
27 0.11
28 0.11
29 0.1
30 0.06
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.06
40 0.06
41 0.07
42 0.07
43 0.07
44 0.09
45 0.12
46 0.12
47 0.13
48 0.18
49 0.23
50 0.26
51 0.31
52 0.33
53 0.33
54 0.36
55 0.35
56 0.31
57 0.27
58 0.24
59 0.18
60 0.14
61 0.1
62 0.07
63 0.07
64 0.06
65 0.06
66 0.07
67 0.08
68 0.09
69 0.09
70 0.13
71 0.15
72 0.15
73 0.14
74 0.14
75 0.15
76 0.15
77 0.15
78 0.12
79 0.13
80 0.16
81 0.16
82 0.16
83 0.14
84 0.13
85 0.14
86 0.16
87 0.16
88 0.14
89 0.16
90 0.22
91 0.29
92 0.38
93 0.44
94 0.52
95 0.58
96 0.67
97 0.73
98 0.77
99 0.81
100 0.82
101 0.84
102 0.85
103 0.85
104 0.85
105 0.88
106 0.87
107 0.85
108 0.85
109 0.84
110 0.81
111 0.74
112 0.65
113 0.61
114 0.53
115 0.46
116 0.37
117 0.29
118 0.21