Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A443HNM9

Protein Details
Accession A0A443HNM9   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
133-155PSESEYDKKHHHHHRKLLDRIDLBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.5, cyto 14, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR016191  Ribonuclease/ribotoxin  
Gene Ontology GO:0003723  F:RNA binding  
GO:0004540  F:RNA nuclease activity  
Amino Acid Sequences MSAEIYYLPSGCNCDGTGYTRTDIQNAADKALFLASQHQTLGRDKYPHAYNDYEHFSFKHAQKPYLEFPIERNGKTYDGGSPGADRVVIGSIAEDYSSAVFCAVITHDGSTNNGFTECQDDTMNVRGKGKYEPSESEYDKKHHHHHRKLLDRIDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.2
4 0.23
5 0.22
6 0.22
7 0.26
8 0.26
9 0.25
10 0.24
11 0.23
12 0.27
13 0.25
14 0.27
15 0.22
16 0.21
17 0.2
18 0.19
19 0.17
20 0.09
21 0.14
22 0.14
23 0.14
24 0.15
25 0.16
26 0.17
27 0.21
28 0.25
29 0.23
30 0.24
31 0.24
32 0.3
33 0.32
34 0.33
35 0.33
36 0.3
37 0.28
38 0.3
39 0.35
40 0.29
41 0.26
42 0.24
43 0.23
44 0.27
45 0.28
46 0.31
47 0.27
48 0.29
49 0.31
50 0.36
51 0.36
52 0.36
53 0.34
54 0.27
55 0.27
56 0.33
57 0.33
58 0.29
59 0.28
60 0.23
61 0.23
62 0.23
63 0.22
64 0.14
65 0.14
66 0.14
67 0.12
68 0.11
69 0.1
70 0.1
71 0.09
72 0.07
73 0.05
74 0.05
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.05
91 0.06
92 0.06
93 0.07
94 0.08
95 0.09
96 0.11
97 0.11
98 0.11
99 0.1
100 0.1
101 0.1
102 0.09
103 0.13
104 0.12
105 0.12
106 0.12
107 0.13
108 0.15
109 0.22
110 0.27
111 0.24
112 0.27
113 0.26
114 0.27
115 0.32
116 0.37
117 0.36
118 0.35
119 0.38
120 0.4
121 0.47
122 0.49
123 0.49
124 0.47
125 0.46
126 0.48
127 0.5
128 0.55
129 0.58
130 0.66
131 0.7
132 0.75
133 0.82
134 0.85
135 0.88