Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A443I4H2

Protein Details
Accession A0A443I4H2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
37-59DASSRRFIRRHVMKGKNRKPIASHydrophilic
NLS Segment(s)
PositionSequence
45-54RRHVMKGKNR
Subcellular Location(s) plas 21, mito 3, cyto 1, pero 1, golg 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR021858  Fun_TF  
Pfam View protein in Pfam  
PF11951  Fungal_trans_2  
Amino Acid Sequences MAAPGVCTKAKAIKSSSSYGSSDPFIVATGQDSIKPDASSRRFIRRHVMKGKNRKPIASSQLALGSWINNAHDLNAFQMATTSMDSLHGPFATPVGLQLNSSTPSLLGFAEMEPRMLHLIYDFVTIMKKIMYPVECCVDLRNEEQNWFRDLSHDPAYAHTILSTARAYFDFVGSQTFGPRAIMHMNKTMFRLRNKLAETDLVITDSTIFTVLALVLVSEAFDDHEAAQKHLHGLHELVKLRGGIRGLSQKPLLQIKCCRIDLSLALKTGSKPLFFTDDSISWKPYLLDSQKASTITPVHTVCDMPDIRLVNVWLDLRELTTGINLAHQTQCKVSSGLFQEALISVQYRLQHLSYNVHDKQEVLRVAMLTLSIVLLIDIRGISIRYQHLVGKLRAALQSSEHDVNDELLRLTLWLLFVGRVSLLDGPEDALWLGAKLLTISQTLGITTWGEARHILKSFMWVDGIHDKAGKDFFEELKES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.5
4 0.47
5 0.45
6 0.41
7 0.39
8 0.33
9 0.28
10 0.23
11 0.19
12 0.15
13 0.14
14 0.12
15 0.11
16 0.13
17 0.13
18 0.14
19 0.17
20 0.2
21 0.22
22 0.22
23 0.23
24 0.3
25 0.34
26 0.41
27 0.44
28 0.52
29 0.53
30 0.56
31 0.64
32 0.63
33 0.69
34 0.7
35 0.75
36 0.75
37 0.83
38 0.89
39 0.89
40 0.83
41 0.76
42 0.7
43 0.69
44 0.67
45 0.62
46 0.54
47 0.45
48 0.45
49 0.41
50 0.38
51 0.29
52 0.21
53 0.15
54 0.16
55 0.14
56 0.12
57 0.12
58 0.12
59 0.13
60 0.13
61 0.13
62 0.15
63 0.14
64 0.12
65 0.12
66 0.12
67 0.11
68 0.12
69 0.1
70 0.08
71 0.09
72 0.1
73 0.1
74 0.12
75 0.1
76 0.1
77 0.1
78 0.1
79 0.1
80 0.09
81 0.09
82 0.1
83 0.1
84 0.1
85 0.11
86 0.13
87 0.14
88 0.14
89 0.13
90 0.1
91 0.1
92 0.11
93 0.1
94 0.08
95 0.07
96 0.07
97 0.13
98 0.13
99 0.13
100 0.12
101 0.13
102 0.13
103 0.12
104 0.12
105 0.07
106 0.08
107 0.08
108 0.1
109 0.09
110 0.08
111 0.09
112 0.09
113 0.1
114 0.09
115 0.09
116 0.09
117 0.13
118 0.16
119 0.17
120 0.19
121 0.22
122 0.22
123 0.22
124 0.22
125 0.2
126 0.2
127 0.21
128 0.25
129 0.23
130 0.25
131 0.29
132 0.29
133 0.29
134 0.28
135 0.25
136 0.22
137 0.23
138 0.25
139 0.25
140 0.25
141 0.23
142 0.23
143 0.26
144 0.23
145 0.21
146 0.16
147 0.12
148 0.1
149 0.12
150 0.11
151 0.08
152 0.08
153 0.09
154 0.1
155 0.1
156 0.1
157 0.09
158 0.09
159 0.1
160 0.1
161 0.1
162 0.09
163 0.09
164 0.09
165 0.09
166 0.08
167 0.09
168 0.13
169 0.15
170 0.17
171 0.22
172 0.23
173 0.24
174 0.27
175 0.31
176 0.31
177 0.31
178 0.35
179 0.32
180 0.37
181 0.38
182 0.37
183 0.32
184 0.29
185 0.27
186 0.23
187 0.21
188 0.14
189 0.12
190 0.11
191 0.1
192 0.08
193 0.07
194 0.05
195 0.04
196 0.04
197 0.04
198 0.04
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.03
205 0.02
206 0.03
207 0.03
208 0.03
209 0.04
210 0.04
211 0.09
212 0.09
213 0.1
214 0.11
215 0.11
216 0.11
217 0.12
218 0.13
219 0.09
220 0.1
221 0.14
222 0.19
223 0.19
224 0.18
225 0.18
226 0.18
227 0.17
228 0.18
229 0.13
230 0.08
231 0.1
232 0.18
233 0.18
234 0.2
235 0.21
236 0.2
237 0.23
238 0.29
239 0.27
240 0.24
241 0.28
242 0.31
243 0.36
244 0.35
245 0.32
246 0.26
247 0.27
248 0.26
249 0.27
250 0.24
251 0.2
252 0.2
253 0.2
254 0.2
255 0.24
256 0.21
257 0.15
258 0.13
259 0.14
260 0.18
261 0.18
262 0.2
263 0.17
264 0.18
265 0.23
266 0.24
267 0.24
268 0.19
269 0.2
270 0.18
271 0.16
272 0.2
273 0.16
274 0.2
275 0.21
276 0.22
277 0.24
278 0.24
279 0.24
280 0.2
281 0.19
282 0.15
283 0.19
284 0.17
285 0.16
286 0.16
287 0.16
288 0.14
289 0.19
290 0.18
291 0.14
292 0.17
293 0.17
294 0.16
295 0.17
296 0.17
297 0.11
298 0.13
299 0.13
300 0.09
301 0.09
302 0.09
303 0.09
304 0.09
305 0.08
306 0.06
307 0.06
308 0.07
309 0.06
310 0.08
311 0.08
312 0.1
313 0.13
314 0.14
315 0.15
316 0.16
317 0.17
318 0.16
319 0.17
320 0.15
321 0.18
322 0.2
323 0.22
324 0.21
325 0.2
326 0.19
327 0.18
328 0.18
329 0.13
330 0.1
331 0.07
332 0.09
333 0.1
334 0.11
335 0.13
336 0.13
337 0.16
338 0.17
339 0.22
340 0.24
341 0.32
342 0.32
343 0.32
344 0.32
345 0.29
346 0.3
347 0.32
348 0.29
349 0.21
350 0.21
351 0.19
352 0.19
353 0.18
354 0.15
355 0.08
356 0.07
357 0.06
358 0.04
359 0.04
360 0.03
361 0.04
362 0.04
363 0.04
364 0.04
365 0.04
366 0.05
367 0.06
368 0.06
369 0.1
370 0.12
371 0.14
372 0.15
373 0.18
374 0.24
375 0.3
376 0.3
377 0.31
378 0.3
379 0.32
380 0.32
381 0.32
382 0.26
383 0.22
384 0.25
385 0.26
386 0.27
387 0.23
388 0.23
389 0.21
390 0.23
391 0.21
392 0.18
393 0.13
394 0.1
395 0.11
396 0.1
397 0.1
398 0.08
399 0.08
400 0.07
401 0.08
402 0.08
403 0.08
404 0.08
405 0.08
406 0.07
407 0.08
408 0.1
409 0.09
410 0.1
411 0.1
412 0.11
413 0.11
414 0.11
415 0.09
416 0.07
417 0.07
418 0.07
419 0.07
420 0.06
421 0.06
422 0.06
423 0.07
424 0.08
425 0.09
426 0.09
427 0.11
428 0.1
429 0.11
430 0.11
431 0.11
432 0.1
433 0.1
434 0.13
435 0.12
436 0.13
437 0.15
438 0.17
439 0.22
440 0.23
441 0.25
442 0.21
443 0.27
444 0.28
445 0.27
446 0.26
447 0.2
448 0.23
449 0.28
450 0.29
451 0.24
452 0.25
453 0.24
454 0.26
455 0.29
456 0.25
457 0.21
458 0.24
459 0.24